KEGG   Apis mellifera (honey bee): 551313Help
Entry
551313            CDS       T01057                                 

Gene name
GB19283
Definition
calcineurin subunit B type 2-like
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ame  Apis mellifera (honey bee)
Pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:ame00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    551313 (GB19283)
Protein phosphatases and associated proteins [BR:ame01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     551313 (GB19283)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG11
AA seq 162 aa AA seqDB search
MELCSNFDVDEIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVIDIFDADGNG
EVDFKEFIHGVSQFSVKGDKESKLRFAFRIYDMDNDGFISNGELFQVLKMMVGNNLKDTQ
LQQIVDKTILFADKDEDGKISFEEFCSVVGNTDIHKKMVVDV
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggaactatgttccaattttgatgttgatgaaattagaagattaggaaaacgatttcgg
aagttagatttagataatagtggtgctttaagcattgatgagtttatgtcattgccagaa
ttacaacaaaatcctttagtacaacgtgttatagatatattcgatgctgatggtaatgga
gaagtagattttaaagaatttattcatggtgtttctcaattcagtgttaagggagataaa
gaaagtaaattaagatttgcatttagaatttatgatatggataatgatggttttataagc
aatggagaattatttcaagtattaaaaatgatggttggtaataacttgaaagatacacag
ttacaacaaattgttgataaaacaatattatttgctgataaggatgaagatggcaaaatt
agtttcgaagaattttgttctgttgttggtaatacagatattcataagaaaatggtggtt
gatgtttaa

DBGET integrated database retrieval system