KEGG   Apis mellifera (honey bee): 551365Help
Entry
551365            CDS       T01057                                 

Gene name
GB13701
Definition
lymphokine-activated killer T-cell-originated protein kinase-like
Orthology
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     551365 (GB13701)
Protein kinases [BR:ame01001]
 Serine/threonine protein kinases: Other group
  TOPK family
   551365 (GB13701)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG3
AA seq 343 aa AA seqDB search
MAEFKTPIIKKCRSRVEDNPELQTPIKIPASPFLQQIGYGCGVTVFSLERSPKVGFIRSP
WAIKKRNSKIVKDKKYNERIQFEAEILRKLNHPNIIGFRAFSKLPNGEPCLAMEKLDASL
GDRIEQKLDIDDDPFPANDILKIMYEIAKGLEYLHHVAYILHGDIKSYNVLISSDYKIVK
LCDFGVSLPLTETLEVDTSNGNFNYVGTECWSAPEIIFEDGPVTNKADIWACGLVVWEMI
ALSAPHIESSEMDDSYLDDSMLEMKMNITNEYDTNMDDSNSFLNKIVNTKYGTRPSLPAI
NLGKEYEKVLEVFFACTTSDYKVRPSAKGLVNYFENYVFNSKK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggctgaatttaaaacaccaataataaaaaagtgtaggagtagagtagaagataatcca
gaattgcaaacacctattaaaataccagcctcaccgtttttacaacaaataggttatgga
tgtggagttactgtatttagtttggaacgatcaccaaaagtcggttttattcgttcacca
tgggcaataaaaaaacgtaattccaaaattgtaaaagataaaaaatataatgaacgtatt
caatttgaagcggaaatacttcgtaaattaaatcatccaaatattattggttttcgagct
tttagtaaacttccaaatggtgaaccatgtttggcaatggaaaaattagatgcttcttta
ggtgacagaatagaacaaaaacttgatattgatgatgatccatttcctgctaatgatatt
ttgaaaataatgtatgagattgcaaaaggattagaatatttgcatcatgttgcttatatt
ttgcatggtgatataaaaagttataatgtattaatctcttcagattataaaatagttaaa
ctatgtgattttggagtatctttaccactcacagagactttagaagtagatacttcaaat
ggaaatttcaactatgtaggaactgaatgttggagtgctccagaaataatatttgaagat
ggtcctgttacaaataaagcagacatttgggcatgtggtcttgtagtttgggaaatgata
gctttgtcagcacctcacatagaatcctcagaaatggatgattcttatctagatgattca
atgttagaaatgaaaatgaatataacaaatgaatatgacaccaatatggatgacagcaat
agttttcttaataaaatagtcaatacgaaatatggtactcgtccttcattacctgctatt
aatctaggaaaagaatatgaaaaagtacttgaagtattttttgcatgcactacttcagat
tataaagttaggcctagtgcaaaaggtcttgttaattactttgaaaattatgtatttaat
agtaaaaagtaa

DBGET integrated database retrieval system