KEGG   Apis mellifera (honey bee): 551401Help
Entry
551401            CDS       T01057                                 

Gene name
ALDH1L2, GB12327
Definition
aldehyde dehydrogenase 1 family, member L2
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
ame  Apis mellifera (honey bee)
Pathway
One carbon pool by folate
Class
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ame00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG8
AA seq 900 aa AA seqDB search
MAQLKVAIIGQSNFAAEVYKLLKLNGHQITGVFTIPDKGNREDPLAITAKIDNTPVFKIK
SWRSKGVTLPEVLQLYKGIEVDLNVLPFCSQFIPMEVINHPRHRSICYHPSLLPRHRGAS
AITWTLIEGDDTAGFSIFWADDGLDTGPILLQRSCKVNSNDTLDSLYNNFLYPEGIKAMA
EAVNLVAKGTAPMIPQTEEGATYDPMMNKKELQKIDWTKPAKQVHDFIRSLDSTPGAWTI
IDGEEVRLFGSTLWNDDQIPEHEIEVNVENRLGIIHKDGLLIKAIDNHFVNVERMKVGTR
TILASKFGQKSEDTIIEFTAEEQKMIESLKRTWEGILNMDVNEDTDFFACGAGSMDVIRL
VEEVKDNLGVILQNIDVFMSPVFIQFVNKVVLTARGISTSKEIKYDAVEVQTNNMTLKFP
RQLFINGEFVNGHGNPIDTINPHDETIICSVETGTVEDVDKAVKAAKKAFEEGEWSKISA
RERGVLLFKLADLMEEHKEELATIESIDSGAVYTLALKTHIGMSIETWRYFAGWCDKIQG
STIPITHARPNRNLTFTRKEPIGVCGLVTPWNYPLMMLSWKMAACLAAGNTVVMKPAQAS
PLTALKFAELTARAGFPPGVVNIVPGNGTETGNAICEHLLIRKLGFTGSTQIGQSIMKSC
ANSNLKKVSLELGGKSPLVIFEDTDLQQAIKIAMSSVFFNKGENCIAAGRLFVEETIHDE
FLQRIVEETKKISIGNPLDRSTAHGPQNHKAHLNKLLKFVERGVKEGAKLIYGGKRLDRP
GWYFEPTIFTDVKDDMYIAKEESFGPIMVISKFSSKNIDDMIARANNTEYGLASGILTKD
ISKALRFAEKIEAGTVFINTYNKTDVAAPFGGFKMSGFGKDLGQEALNEYLKTKTITVEY
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaactcaaagtggcaataatcggtcaaagcaacttcgcagccgaggtttacaaa
cttctgaaactgaacggtcatcaaatcacaggggtctttaccattcctgacaaagggaat
cgagaagatcctctggccataacagcaaaaatcgataatactccagtttttaagatcaaa
tcttggagaagcaaaggagtgaccttgccggaagtgcttcagttatataaaggaatcgaa
gttgatttaaatgttcttccattctgcagtcaattcattcccatggaggtcatcaatcat
cctcgtcatcgtagtatatgttaccatccatctttactaccaagacatagaggagctagt
gctattacctggactctgatagaaggagatgacacagcaggtttctctattttctgggcc
gatgatggtctcgatactggaccaatcttgctccaaagatcatgtaaagtaaactccaat
gatactttggattctttgtacaataactttttgtatcccgaaggaattaaggccatggcg
gaggctgtaaatcttgtagctaaaggaaccgctcctatgattcctcaaacggaagaggga
gccacttacgatcctatgatgaataaaaaagaacttcaaaaaatagactggactaagccc
gcaaaacaagttcatgatttcatacgtagtcttgatagcactccaggtgcctggactatt
atcgatggtgaagaagttcgtctatttggttctaccttatggaatgatgatcaaataccc
gaacacgagattgaagtgaatgtagagaatagattgggcatcattcataaggatggactg
ttaattaaagctattgataatcactttgtcaatgtggaaagaatgaaagttggaactaga
actattcttgcaagcaaatttggtcagaagagtgaagataccataattgaatttactgca
gaggaacaaaaaatgatagaatccttgaagcggacttgggaaggtattctaaacatggac
gttaacgaggatacagacttctttgcctgcggtgcaggaagtatggatgttataagatta
gtagaagaggtaaaagacaatttgggagtaattttgcaaaatatcgacgtcttcatgtct
ccggttttcattcaatttgtaaataaagtagttttaacagcacgaggtatttctacctct
aaagaaatcaaatacgatgctgtggaagtacaaacgaacaatatgactttgaaattccct
agacaattatttattaatggagaatttgtaaatggccatggaaatcctatagatacaatt
aatcctcatgacgaaacaattatttgttctgttgaaaccggcactgtggaggatgtggac
aaggcagttaaggcagccaagaaagcttttgaagaaggagaatggagcaaaattagcgcc
agagagcgtggagttcttcttttcaaattagcagacctaatggaagaacataaagaagaa
ttagcaactatagagagcatagattctggtgcggtatatacattagccttgaagacccat
ataggaatgtccatcgaaacttggagatatttcgctggttggtgtgataagattcaaggc
tctaccataccaataactcatgccagaccaaatcgtaatttaaccttcacccgaaaagag
cctattggtgtctgtggcctggttactccttggaattatcctttgatgatgctttcttgg
aagatggcagcttgcttggcagcaggcaacactgtggtaatgaaaccagcacaagcttca
cctttaacagctttgaaattcgcagaattaactgcaagagctggtttcccacctggagtg
gtgaatatcgtgccaggaaacggaactgagactggaaatgcaatttgtgaacatcttcta
atcagaaaactgggttttactgggtctacgcaaattggacagtctataatgaaatcttgt
gcaaatagtaatttgaagaaagtatccctagaattaggtggaaaaagtcctttagttatt
ttcgaagatactgatttacagcaagcaattaaaattgcaatgagcagcgtgttcttcaac
aaaggagaaaactgtatagctgctggtcggctatttgtggaagagacaattcatgatgaa
ttcttgcaaaggatagtggaggagactaagaagatttccataggaaatcccctggataga
agcacagcccatgggccacagaaccataaagctcatttaaacaaacttttgaaatttgtg
gaacgtggcgttaaagaaggagctaaattaatttatggtgggaaaagattagatcgtcca
ggatggtattttgagccaacaatattcacagacgtgaaagatgacatgtacatagctaaa
gaggaatcttttggtcccatcatggttatttccaaattcagctcgaagaacatagatgat
atgattgcaagagcgaataatacagaatatggattggcttctggtatcttgacaaaggat
atcagtaaagctcttagatttgccgagaaaatagaagctggaacagtattcattaatact
tataataagacagatgtggctgcaccttttggtggtttcaaaatgtctggttttggtaaa
gatctgggtcaagaagctttgaacgaatatctaaaaacaaaaactatcactgtagaatat
tag

DBGET integrated database retrieval system