KEGG   Apis mellifera (honey bee): 551420Help
Entry
551420            CDS       T01057                                 

Definition
protein O-mannosyltransferase 1-like
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ame  Apis mellifera (honey bee)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    551420
Enzymes [BR:ame01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     551420
Glycosyltransferases [BR:ame01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   551420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG1
AA seq 781 aa AA seqDB search
MIVRRRRRILDNKQSQVQSAKFEYEHISTNCNENVQRDEKDEIVSNTIEKFKIVEIPVNT
ALKTRIKISLEIDLISVILLVTGIVTRFYRLEEPRSIVFDELHYGKYVGLYMKKTFFFDS
HPPLGKQLISAAAYVAGFDGQFKFDRIGSPYSDIVPLFALRLVPALCGSLLIPTAYHLIL
ELGLKQWTATLAGILLLFDNALLTQSRFILMESILMQFSLFGLICIMKFRKVMDQPTNLS
WWIWLILGIANLTCALCVKYVGLYSLILSLFLIAYDYWNLIPRKTLSSTVLCIHLIIRIF
VILSIICIIYLTVFYIHLTTLSKAGPHDSVMTSAFQASLDGGLASITKGQPLEVTHGSQI
TLRHTYGRACWLHSHNHMYPLRYPDGRGSSHQQQVTCYSFKDVNNWWIVKKPERNDLVVT
KPSEPIKHGDIIQLVHGITSRALNSHDVAAPMTPQSQEVSCYIDYNVSMPAQNFWKVEIS
NKDSTGDVWHAIQSQVRLIHVNTDYALKFSGRQLPDWGFNQHEIVADRLIDQTDSIWNVE
EHRYTKSEDQKQRERELINAEMIPLQATTLNFWEKFVELQIKMLFSGQEGQNSHMYSSDP
LDWPLMSRGIAYWVSNDSNAQVHLLGNIAIWYSGTICIIIYSFLLIFYILRRRRMCFDIT
HEEWNKFSNIGSILLTGYLLHFLPFIFVEKTLFLHHYLPAFIFKLLLTAATIEHLYYFIR
IRYRHNFLMYILKFGIITWLIFVIYIFKKFSVLSYGTTNLSAKEVLKLRWKDTWDFIIHK
T
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgatagttcgtcgaagacgaaggatattagataacaagcaatcgcaagtacaaagcgcc
aagtttgagtatgaacatatttctactaattgtaatgaaaatgttcaacgagatgagaaa
gatgaaattgtttcaaatacaatagaaaaatttaaaatagtagaaataccggtaaataca
gcactaaaaactcgaattaaaattagtttagagattgatttaatttcagttattttattg
gtaactggaattgttactcgattttaccgtttagaagaaccacgaagtatagtgtttgat
gaattacattatggaaaatacgtagggctttatatgaaaaaaacattcttttttgattca
catcctcctttaggaaagcaacttatttctgcagcggcgtatgttgctggtttcgatggt
caatttaaatttgatagaataggcagtccttattcggatattgtgcctctattcgcatta
cgattagtaccggcattatgcggtagtctattaattcccacagcttatcatttaattttg
gaattaggcctaaaacaatggactgctactttagcgggaattttattattattcgataat
gctttgttaactcaatctagatttattttaatggaaagtattttaatgcaattttcatta
tttggattaatatgcataatgaaatttagaaaagtaatggatcaaccaacaaatttatct
tggtggatatggttaattttaggaattgcaaatttaacatgtgcattatgtgtcaaatat
gttggattatattcattgattttatcattatttttaattgcttatgattattggaattta
ataccgagaaaaactttatctagtacagtattatgcattcatcttataataagaattttt
gtaatattaagtatcatttgtattatatatttgactgtgttttacatacatttaacaaca
ctttctaaagctggaccacatgattcagtaatgacgagtgcttttcaagcaagtttagat
ggtggtttagctagcattacaaaaggccaacctctagaagttacacatggatcacagatt
actttaagacatacatatggaagagcttgctggcttcatagtcataatcatatgtatcca
ttaagatatccagatggaagaggtagttctcatcaacaacaagttacttgttattcattt
aaagatgttaacaattggtggattgtaaaaaaaccagaaagaaatgatttagttgttaca
aaacctagtgaaccaataaagcatggtgatataatacaattagtacatggaattacaagt
cgagcattaaattcacatgatgttgctgctccaatgacacctcagagtcaagaggtatct
tgttatattgattataatgtatctatgcctgctcaaaatttttggaaagtggagattagt
aataaagatagtactggtgatgtttggcatgcaattcaaagtcaagtacgattgatacat
gtaaatacagattatgcattaaaatttagtggaagacaattgcctgattggggtttcaat
cagcatgaaatagttgcagatagattaatagatcaaacagattccatatggaatgttgaa
gaacatagatatactaaaagtgaagatcagaaacaaagagaaagggagttgattaatgct
gaaatgattccattacaagctactactttgaatttttgggaaaaatttgtagaattacaa
ataaaaatgctgtttagtggccaagaaggacaaaatagtcacatgtattctagtgatcct
ttagattggccattaatgtctagaggaattgcatattgggtttccaatgatagtaatgct
caagtgcatcttttaggaaatatagcaatttggtattctggcacaatatgtataattata
tattcatttcttttaatattttatattttaagaagaagacgaatgtgttttgatattaca
catgaagaatggaacaaattttctaatattggaagtatcttattaactggatatttatta
cattttttaccttttatatttgttgaaaagactctgtttcttcatcattatttaccagcg
ttcatctttaaattattgcttacagcagcaacaatagaacatctatattattttattaga
attcggtatcggcacaattttttaatgtatatattaaaatttggtattattacatggtta
atttttgtcatttatatatttaaaaaatttagtgttcttagttatggtacaaccaatttg
agtgccaaggaagttttaaaattaagatggaaagacacatgggattttattatacataaa
acataa

DBGET integrated database retrieval system