KEGG   Apis mellifera (honey bee): 551435Help
Entry
551435            CDS       T01057                                 

Gene name
Pdi, GB12586
Definition
protein disulfide isomerase
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
ame  Apis mellifera (honey bee)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ame00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    551435 (Pdi)
Enzymes [BR:ame01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     551435 (Pdi)
Exosome [BR:ame04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   551435 (Pdi)
  Exosomal proteins of colorectal cancer cells
   551435 (Pdi)
  Exosomal proteins of bladder cancer cells
   551435 (Pdi)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG10
AA seq 817 aa AA seqDB search
MKIFALTIVIICFFTFSLAKIEIEDSVLVLTKDNIEEAIEQNDYLLIEFYAPWCGHCKAL
APEYAKAAKKLQDGGFPIKLAKVDAIIETELAEKHGVRGYPTLKFYRKGSAIDYSGGRQA
DDIVNWVIKKSGPAAKNLSTVEEAKSFIESHNIAIIGFFKDIESDGAKVFLEVGNAVDDH
VFGISNNDKVFNEYGVEDGKIVLFKKFDEGRKEFNEELDVKKLQNFISVHSLPLVVDFNQ
DTVQKIFSGDIKSHLLVFLSKEAGHFEEYVDKIKEPAKKFRGEVLFVTINADESDHERIL
EYFGMKKSEVPAMRIIKFEQIMAKYKPEKPEISSENVLEFVTAFIEGKLKRHFLTQDLPE
DWDKNPVKVLVGTNFHEVAYDKKKNVLVEFYAPWCGHCKQLAPIYEALGEKYKDSENLVI
AKMDATANELKDVKVSSYPTITLYKKETNEAVEYNGERTLEGLSKFIDSDGAYGQAAEEK
QDSRVTMEDLQNFNLSKLIKFLHRTLILTEEVKTILKANCEEAMYCLQPWCVEVNPQQEV
NKSICTCLKSKDEDEEIAADISRTLLQTQQLREKSSLNIKNQKFFNIHEYYQKTENKKKK
KIQNLNVNNKNMHLKQDLNATKQNNQNMKNDKEVQNEIDTYTIKKTKNNNQLLINSIKFK
GTKNFLAINKRNVKNIEKVNQCRNINHKLENKIKSNCSIKESKYCKFDEKYSATSISELK
NLIQKMSVKSNDCTLINKCNIKCPLHENTISHCTFDQKIIIGTIIDNFNRNNISEEIIKS
LKIYHTYLNIDFTKKLFIQKHQKVLHIFLIEFNXMVR
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgaagatttttgcattaacaattgtaataatttgtttttttacttttagtcttgcaaaa
attgaaatcgaagattcggttttagtgcttacaaaagataacatcgaagaagcaatcgaa
caaaatgattacctgctcattgaattttatgcaccatggtgtggacattgtaaagcttta
gcgcctgaatatgccaaagcagctaaaaaattacaggatggtggttttcctataaaatta
gctaaagttgatgcaattattgaaacagaattagctgaaaaacatggagttcgtggatat
cctactcttaaattttatcgtaaaggatcggctattgattatagtggaggtcgtcaagca
gatgatattgtaaattgggtaataaaaaaatcaggccctgctgcaaaaaatttatcaaca
gttgaagaagctaaatcatttattgagtcacataatattgctattattggattctttaag
gatatagaatcagatggtgcaaaagtatttttagaagttggtaatgctgttgatgatcat
gtatttggtataagtaataatgataaagttttcaatgagtatggagtagaagatggtaaa
attgttttgtttaaaaagtttgatgaaggcagaaaagaatttaatgaggaacttgatgtt
aaaaaattacaaaacttcatttctgtacattcactgccattagttgttgatttcaatcaa
gatacagtacaaaagatatttagtggtgatatcaaaagccatcttcttgtcttccttagc
aaagaagctggtcattttgaagaatatgtagataaaattaaagaaccggcaaaaaaattc
cgtggagaggttttatttgtgacaattaatgctgatgaatctgatcatgaacgcatctta
gaatattttggtatgaaaaaaagtgaagtacctgctatgcgtattataaaatttgaacaa
attatggctaaatacaaaccagaaaagccagaaatatccagtgaaaatgttttggaattt
gtaactgcatttattgaaggcaaattgaaaaggcattttcttacgcaagatttgccagaa
gattgggataagaatcctgtgaaagttcttgttggtactaacttccatgaagttgcatat
gataaaaagaaaaacgttttagttgaattttatgctccatggtgtgggcattgcaaacaa
ctagctcctatatatgaagcacttggagaaaaatataaagacagtgaaaatttagttata
gcaaaaatggatgctactgcaaatgaattaaaagatgttaaagttagtagttatccaaca
attactctttataaaaaagaaacaaacgaagctgtagaatataatggcgaaagaacgctt
gaaggactttctaaatttattgattctgatggtgcttatggtcaagctgcagaagaaaaa
caagattcaagagtaacaatggaagatttacaaaatttcaatctttcaaaattaattaaa
tttttacatcgaaccttgattctgacagaagaagtaaaaactatattaaaagcaaattgt
gaagaagcaatgtattgtttacaaccatggtgcgtagaagttaatcctcaacaagaagtt
aataaaagtatttgtacttgtctcaaatccaaagatgaagatgaagaaattgctgcagat
attagtagaacattattacaaacacaacaattacgagaaaaatcatctttaaatataaaa
aatcaaaaatttttcaatatacatgaatattatcaaaaaactgaaaataagaaaaaaaaa
aagattcaaaatttaaatgttaataataagaacatgcatttaaaacaagatcttaatgct
acaaaacaaaataatcaaaatatgaaaaatgataaagaagtacaaaatgaaatagataca
tatacaattaaaaaaacaaagaataataatcaattattaataaattcaataaaatttaaa
ggaactaaaaattttcttgcaataaataaaagaaatgttaaaaacattgaaaaagttaat
caatgcagaaacattaatcataaattggaaaataaaattaaatctaattgttccataaaa
gagtcaaaatattgtaaatttgatgaaaaatattctgcaacatcaattagtgaattgaaa
aatctaatacaaaaaatgtcagttaaatctaatgattgtacactgattaacaaatgtaat
ataaagtgtccattacatgaaaacacaatttctcattgtacctttgaccagaaaataata
attggtactattatagataactttaatagaaataatatttcagaagaaataattaaatca
ttaaaaatttaccatacttatttaaatattgattttacaaaaaaattatttattcaaaaa
catcagaaagtattacatatatttttgatagaatttaatanaatggtaagatga

DBGET integrated database retrieval system