KEGG   Apis mellifera (honey bee): 551500Help
Entry
551500            CDS       T01057                                 

Gene name
GB19635
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta isoform-like
  KO
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
ame  Apis mellifera (honey bee)
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Longevity regulating pathway - multiple species
AGE-RAGE signaling pathway in diabetic complications
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    551500 (GB19635)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    551500 (GB19635)
   04070 Phosphatidylinositol signaling system
    551500 (GB19635)
   04150 mTOR signaling pathway
    551500 (GB19635)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    551500 (GB19635)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    551500 (GB19635)
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     551500 (GB19635)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BEEBASE: 
Position
LG11
AA seq 1050 aa AA seqDB search
MVHIPSAYTYNFWAKSPTEVIELTCLMPNGVVIPLETNRNITLAEIKEDLWDEASKYPLH
GTLKDAPSYVFSCINSNAEAEELRDETRRLCDIKPFCSVLKVIEREGVKSDRNLDSRIGV
LIGKGLHEFTALRNSEVNDFRWKMRVLGDEVAMARQKKSWMEKVRYQFPTRLAPTATIPK
NIECRLKDGNIVLVTKFENTETAFTFQISHSTTPYQLLVSILNKRANTLMSKGHPNDFTL
KVCGQEEYLIGDYPLIQFSYIQDCVAKDITPTLVTLSRDSVSVDQENTSENIEADTLQRT
RPSFSTLTLRKKGKHVSAWKIEEPFVFTVNAISRLNCDAAHRTVEIGLQAGLFHGGKSLC
ESQKTKETVVNSDGSCEWEETLKFDIKVRDIPRMARLCFVLYEISKTAKGLKSRRLVKDT
KQEFFINPLCWANTTIYDFKSQLKTGAMTLYTWTYAEDMQNDDLLHPLGTVVSNPHIDRA
AALMLTFPNYGKEKSVLYPTPEKMVEYARKLRESSTERSIQEEPNQESDVGKQQLEQLRL
LADRDPLHELHEQERKIMWTLRHHCLLEIPTLLAKLLHCVEWNDHREVAEATALVQQWPK
LSVEKALELLDYAYADQNVRSFAVRCLMDVSDEDLSLYLLQLVQALKHENYLSCDLTEFL
LRRALNNRRIGHFLFWHLRGSQQHMRSLFKQMECLGKLKSASEQIKQRKDRKAALQGFQE
FIQEPHCQDALSNVLNPLDPSFRWKRIKIEKCRVMDSKMRPLWLVFENTDPFGDDIYLIL
KHGDDLRQDMLTLQMLRIMDKLWKREGLDLRMNPYGCISTENRVGMIEVVLNAETIANIQ
KEKGTFSATAAFRRGSLLAWLKDHNHTEAALNRAIEEFTLSCAGYCVATYVLGIADRHSD
NIMVKKTGQLFHVDFGHILGHFKEKFGFRRERVPFVLTNDFVHVINKGQTKKGQAVEFQR
FQSHCEQAFLVLRQHGGLILSLFAMMISTGLPELSSEKDLNYLRDTLVLEMSESEAQKHF
RSKFDEALCNSWKTSLNWASHNMSKNNKTT
NT seq 3153 nt NT seq  +upstreamnt  +downstreamnt
atggttcatataccaagtgcgtatacttataatttttgggcgaaatcacccacagaagtt
attgaacttacttgtttaatgccaaatggggtcgttatacccttggaaactaatcgcaat
attactttggccgaaattaaagaggatctctgggatgaagccagcaaatatcctcttcat
ggtacattaaaagatgctccgtcctatgtattttcatgtattaactcgaatgcagaagcg
gaagaattacgagatgaaactagacgtttgtgcgatattaaaccattttgttctgtgctt
aaagttatagagcgtgaaggtgttaaaagtgatagaaatttagattctcgaatcggtgtt
cttattggcaaaggattacacgagtttacagcgttaagaaattctgaagtgaatgacttt
aggtggaaaatgagagttttgggagatgaagttgcaatggcaagacaaaaaaaatcttgg
atggaaaaagtacgttatcaatttcctactcgattagcaccaactgccacaataccaaaa
aatatcgaatgtcgattaaaagatggaaatatcgttcttgttactaaatttgaaaataca
gagacagccttcacatttcaaatatcgcatagtacgacgccatatcaattattggtatct
atattaaataaacgagcaaacactttaatgtccaaaggacatccaaatgactttactctg
aaggtttgcggccaggaggaatatttaataggagattatcctttaatacagtttagttat
attcaagattgtgtagcaaaagatattactcctacattggtcactctaagcagagatagc
gtctctgttgatcaagaaaatacttcagaaaatatagaggcagatactttgcaacgtaca
agaccatccttttccacgctaactttacgtaaaaagggtaaacatgtatctgcttggaaa
atagaggaaccgtttgttttcactgtcaatgcgatatcacgattaaactgcgatgcggct
catcgcaccgttgagattggtctccaagccggtctttttcatggtgggaaatctttgtgc
gaaagtcagaagactaaagaaactgtcgtcaattctgacggtagttgcgaatgggaagaa
accttaaagtttgatataaaagtacgagatataccgcgaatggctaggctgtgttttgtt
ttgtatgaaattagtaagactgcgaaaggattgaagagtcgtagattagttaaagatact
aaacaagagttttttataaatccgttgtgttgggctaacacgactatatatgactttaaa
tcacaattaaaaacgggagcgatgacgttatatacgtggacgtatgccgaggatatgcaa
aatgatgatcttttgcatcctttgggaacggtggtgtcaaatcctcatatagatagagcg
gctgctttaatgttaacatttccaaattatgggaaagagaagtcggttctttatcctact
ccggagaaaatggtggaatacgcgagaaagttgcgagaatcatctaccgaacgttcgatt
caagaagaacctaatcaagaatctgatgttggtaagcagcaacttgaacaacttcgatta
ttagcggacagagatccattacacgagcttcacgaacaagaacgaaagataatgtggacg
ttaaggcatcattgtcttcttgaaattcccacgctcttggccaagttgttgcactgcgtg
gaatggaatgatcatagggaagtagctgaagctacggcgctggtgcaacagtggcccaaa
ttatccgtcgaaaaggcgcttgaattattggattatgcttatgctgatcaaaatgttcga
agttttgctgtacgttgtttaatggatgtcagtgacgaggatttgagcctttatctattg
caattggtacaagcgttaaaacatgaaaattatttatcctgcgatttgacggagtttcta
ctgagacgcgcgcttaacaatcggagaatcggtcattttttattttggcatcttagggga
agtcagcagcatatgcggtcactatttaaacaaatggaatgtttgggtaaattgaaaagt
gcttccgaacaaataaaacagagaaaagaccggaaagctgcgttacaaggatttcaagaa
tttattcaagaaccccattgtcaagatgcgctgtcgaacgttttaaatccattggatccg
agtttccgatggaaacgcattaaaattgaaaaatgtagagtaatggatagtaaaatgcga
ccactttggctagtttttgaaaataccgatccattcggcgacgatatttacttgatacta
aaacatggagatgatttgagacaagatatgcttacgctacagatgctacgaatcatggat
aaactttggaagagagagggtttggatttacgtatgaatccttacggttgcatatcaacg
gaaaatagagtcggtatgatcgaagtggttttaaatgcggaaacaattgcaaatattcaa
aaggaaaagggaactttttcggcaacagctgcttttagacgaggatctttgcttgcttgg
ctaaaagatcataatcataccgaagcagcattgaatagagctatcgaggaatttactttg
agttgcgcgggttattgtgtggctacgtatgttcttggaattgccgatagacattcggat
aatataatggtgaagaaaaccgggcaattatttcatgttgattttggtcatatacttgga
cattttaaagagaaatttggattcagacgtgaacgtgtaccttttgtgttaaccaatgat
ttcgtgcatgtaataaacaagggtcaaacaaagaaaggtcaagcagttgaatttcaacga
tttcagagtcattgtgaacaagcttttctcgttctacggcaacatggaggactaatattg
tccttgtttgccatgatgatatcaacgggattacctgaattatcatcggaaaaagatctt
aattatttgagagatactttggtactcgagatgtcggaaagtgaggcacaaaagcatttt
aggagtaaatttgacgaagctctttgcaattcgtggaaaacttcattaaattgggcctct
cataatatgtccaaaaacaataaaacaacatga

DBGET integrated database retrieval system