KEGG   Apis mellifera (honey bee): 551500Help
Entry
551500            CDS       T01057                                 

Gene name
GB19635
Definition
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta isoform-like
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
ame  Apis mellifera (honey bee)
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    551500 (GB19635)
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    551500 (GB19635)
   04068 FoxO signaling pathway
    551500 (GB19635)
   04070 Phosphatidylinositol signaling system
    551500 (GB19635)
   04150 mTOR signaling pathway
    551500 (GB19635)
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     551500 (GB19635)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG11
AA seq 1050 aa AA seqDB search
MVHIPSAYTYNFWAKSPTEVIELTCLMPNGVVIPLETNRNITLAEIKEDLWDEASKYPLH
GTLKDAPSYVFSCINSNAEAEELRDETRRLCDIKPFCSVLKVIEREGVKSDRNLDSRIGV
LIGKGLHEFTALRNSEVNDFRWKMRVLGDEVAMARQKKSWMEKVRYQFPTRLAPTATIPK
NIECRLKDGNIVLVTKFENTETAFTFQISHSTTPYQLLVSILNKRANTLMSKGHPNDFTL
KVCGQEEYLIGDYPLIQFSYIQDCVAKDITPTLVTLSRDSVSVDQENTSENIEADTLQRT
RPSFSTLTLRKKGKHVSAWKIEEPFVFTVNAISRLNCDAAHRTVEIGLQAGLFHGGKSLC
ESQKTKETVVNSDGSCEWEETLKFDIKVRDIPRMARLCFVLYEISKTAKGLKSRRLVKDT
KQEFFINPLCWANTTIYDFKSQLKTGAMTLYTWTYAEDMQNDDLLHPLGTVVSNPHIDRA
AALMLTFPNYGKEKSVLYPTPEKMVEYARKLRESSTERSIQEEPNQESDVGKQQLEQLRL
LADRDPLHELHEQERKIMWTLRHHCLLEIPTLLAKLLHCVEWNDHREVAEATALVQQWPK
LSVEKALELLDYAYADQNVRSFAVRCLMDVSDEDLSLYLLQLVQALKHENYLSCDLTEFL
LRRALNNRRIGHFLFWHLRGSQQHMRSLFKQMECLGKLKSASEQIKQRKDRKAALQGFQE
FIQEPHCQDALSNVLNPLDPSFRWKRIKIEKCRVMDSKMRPLWLVFENTDPFGDDIYLIL
KHGDDLRQDMLTLQMLRIMDKLWKREGLDLRMNPYGCISTENRVGMIEVVLNAETIANIQ
KEKGTFSATAAFRRGSLLAWLKDHNHTEAALNRAIEEFTLSCAGYCVATYVLGIADRHSD
NIMVKKTGQLFHVDFGHILGHFKEKFGFRRERVPFVLTNDFVHVINKGQTKKGQAVEFQR
FQSHCEQAFLVLRQHGGLILSLFAMMISTGLPELSSEKDLNYLRDTLVLEMSESEAQKHF
RSKFDEALCNSWKTSLNWASHNMSKNNKTT
NT seq 3153 nt NT seq  +upstreamnt  +downstreamnt
atggttcatataccaagtgcgtatacttataatttttgggcgaaatcacccacagaagtt
attgaacttacttgtttaatgccaaatggggtcgttatacccttggaaactaatcgcaat
attactttggccgaaattaaagaggatctctgggatgaagccagcaaatatcctcttcat
ggtacattaaaagatgctccgtcctatgtattttcatgtattaactcgaatgcagaagcg
gaagaattacgagatgaaactagacgtttgtgcgatattaaaccattttgttctgtgctt
aaagttatagagcgtgaaggtgttaaaagtgatagaaatttagattctcgaatcggtgtt
cttattggcaaaggattacacgagtttacagcgttaagaaattctgaagtgaatgacttt
aggtggaaaatgagagttttgggagatgaagttgcaatggcaagacaaaaaaaatcttgg
atggaaaaagtacgttatcaatttcctactcgattagcaccaactgccacaataccaaaa
aatatcgaatgtcgattaaaagatggaaatatcgttcttgttactaaatttgaaaataca
gagacagccttcacatttcaaatatcgcatagtacgacgccatatcaattattggtatct
atattaaataaacgagcaaacactttaatgtccaaaggacatccaaatgactttactctg
aaggtttgcggccaggaggaatatttaataggagattatcctttaatacagtttagttat
attcaagattgtgtagcaaaagatattactcctacattggtcactctaagcagagatagc
gtctctgttgatcaagaaaatacttcagaaaatatagaggcagatactttgcaacgtaca
agaccatccttttccacgctaactttacgtaaaaagggtaaacatgtatctgcttggaaa
atagaggaaccgtttgttttcactgtcaatgcgatatcacgattaaactgcgatgcggct
catcgcaccgttgagattggtctccaagccggtctttttcatggtgggaaatctttgtgc
gaaagtcagaagactaaagaaactgtcgtcaattctgacggtagttgcgaatgggaagaa
accttaaagtttgatataaaagtacgagatataccgcgaatggctaggctgtgttttgtt
ttgtatgaaattagtaagactgcgaaaggattgaagagtcgtagattagttaaagatact
aaacaagagttttttataaatccgttgtgttgggctaacacgactatatatgactttaaa
tcacaattaaaaacgggagcgatgacgttatatacgtggacgtatgccgaggatatgcaa
aatgatgatcttttgcatcctttgggaacggtggtgtcaaatcctcatatagatagagcg
gctgctttaatgttaacatttccaaattatgggaaagagaagtcggttctttatcctact
ccggagaaaatggtggaatacgcgagaaagttgcgagaatcatctaccgaacgttcgatt
caagaagaacctaatcaagaatctgatgttggtaagcagcaacttgaacaacttcgatta
ttagcggacagagatccattacacgagcttcacgaacaagaacgaaagataatgtggacg
ttaaggcatcattgtcttcttgaaattcccacgctcttggccaagttgttgcactgcgtg
gaatggaatgatcatagggaagtagctgaagctacggcgctggtgcaacagtggcccaaa
ttatccgtcgaaaaggcgcttgaattattggattatgcttatgctgatcaaaatgttcga
agttttgctgtacgttgtttaatggatgtcagtgacgaggatttgagcctttatctattg
caattggtacaagcgttaaaacatgaaaattatttatcctgcgatttgacggagtttcta
ctgagacgcgcgcttaacaatcggagaatcggtcattttttattttggcatcttagggga
agtcagcagcatatgcggtcactatttaaacaaatggaatgtttgggtaaattgaaaagt
gcttccgaacaaataaaacagagaaaagaccggaaagctgcgttacaaggatttcaagaa
tttattcaagaaccccattgtcaagatgcgctgtcgaacgttttaaatccattggatccg
agtttccgatggaaacgcattaaaattgaaaaatgtagagtaatggatagtaaaatgcga
ccactttggctagtttttgaaaataccgatccattcggcgacgatatttacttgatacta
aaacatggagatgatttgagacaagatatgcttacgctacagatgctacgaatcatggat
aaactttggaagagagagggtttggatttacgtatgaatccttacggttgcatatcaacg
gaaaatagagtcggtatgatcgaagtggttttaaatgcggaaacaattgcaaatattcaa
aaggaaaagggaactttttcggcaacagctgcttttagacgaggatctttgcttgcttgg
ctaaaagatcataatcataccgaagcagcattgaatagagctatcgaggaatttactttg
agttgcgcgggttattgtgtggctacgtatgttcttggaattgccgatagacattcggat
aatataatggtgaagaaaaccgggcaattatttcatgttgattttggtcatatacttgga
cattttaaagagaaatttggattcagacgtgaacgtgtaccttttgtgttaaccaatgat
ttcgtgcatgtaataaacaagggtcaaacaaagaaaggtcaagcagttgaatttcaacga
tttcagagtcattgtgaacaagcttttctcgttctacggcaacatggaggactaatattg
tccttgtttgccatgatgatatcaacgggattacctgaattatcatcggaaaaagatctt
aattatttgagagatactttggtactcgagatgtcggaaagtgaggcacaaaagcatttt
aggagtaaatttgacgaagctctttgcaattcgtggaaaacttcattaaattgggcctct
cataatatgtccaaaaacaataaaacaacatga

DBGET integrated database retrieval system