KEGG   Apis mellifera (honey bee): 551527Help
Entry
551527            CDS       T01057                                 

Gene name
GB11596
Definition
(RefSeq) acyl-CoA Delta(11) desaturase-like
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame01040  Biosynthesis of unsaturated fatty acids
ame01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    551527 (GB11596)
Enzymes [BR:ame01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     551527 (GB11596)
Lipid biosynthesis proteins [BR:ame01004]
 Desaturase
  First
   551527 (GB11596)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-GeneID: 551527
NCBI-ProteinID: XP_006571891
BEEBASE: GB51238
UniProt: A0A088AI93
Position
Un
AA seq 368 aa AA seqDB search
MILNKKLFQQNVDQETSKTEKENKQKKLIQELSNSELKYKWNIVWKNVIVFIYLHLGGIY
GFYLWINGTKAYTILWSIFVEFFAIMGITAGAHRLWSHRSYKAKWPLRFVLMLLQTTSYQ
NHIYEWVRDHRAHHKFTDTDADPHNSRRGFFFSHIGWLMVRKHPDIFTKGATIDLSDLEK
DPIVVWQRRLYIVLMPLLCFVIPTWVPYYFWNEKFIYSWYSNLARYVFSLNVTWMVNSAA
HIWGMKPYDMNICPVENKIVSIFAYGEGWHNYHHVFPWDYKTSEFGTYNTNFTTAFIDFC
ARLGLAYDLKTVSNEIIRKRAARTGDGSRYDRKEAVHYYNLEDMKWGWGDIDMKPEEIQE
INIYNKSD
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgatattgaataagaaattatttcaacaaaatgttgatcaagaaacatcgaagacggaa
aaagaaaataagcaaaaaaaattaatccaggaattatcgaattccgagctgaaatataaa
tggaatatcgtttggaaaaacgtgattgtatttatctaccttcatcttggaggtatatac
ggattttatctttggattaacggaacgaaggcatatacaattttgtggtcaattttcgta
gaattttttgccattatgggcattacagctggagctcacagattatggtcacatagaagt
tataaagcgaaatggcccttacgcttcgtgttgatgcttcttcaaacaacctcttaccag
aatcacatttatgaatgggtaagagatcatagagctcatcacaaattcactgatactgat
gcggatcctcataattcccgacgaggattttttttctctcacataggctggttaatggtc
cgaaagcatccggatatatttacaaaaggtgccactattgacttaagtgatttggaaaaa
gatcccattgtcgtttggcaaagaagattgtatatcgtgctgatgcctcttttgtgcttt
gtaattcctacatgggtaccctattatttttggaatgaaaaatttatatattcctggtac
agcaatttagcaagatatgttttttccttaaacgtaacatggatggtaaactctgctgct
catatatggggcatgaaaccatatgacatgaacatttgtccagtagaaaacaaaattgta
tctatatttgcatacggcgagggatggcataattatcatcatgtatttccgtgggactat
aaaactagtgaatttggtacctataataccaattttactaccgcattcattgatttctgt
gctcgattaggattggcatacgatttgaagactgtttccaatgaaataattagaaaacga
gcagctagaactggagacggatcgagatatgatagaaaggaagctgttcattactacaat
cttgaagatatgaaatggggttggggcgatatagatatgaagcctgaggaaatccaggaa
atcaatatatacaataagagtgattaa

DBGET integrated database retrieval system