KEGG   Apis mellifera (honey bee): 551527Help
Entry
551527            CDS       T01057                                 

Gene name
GB11596
Definition
acyl-CoA Delta(11) desaturase-like
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ame  Apis mellifera (honey bee)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ame01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ame01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
Un
AA seq 368 aa AA seqDB search
MILNKKLFQQNVDQETSKTEKENKQKKLIQELSNSELKYKWNIVWKNVIVFIYLHLGGIY
GFYLWINGTKAYTILWSIFVEFFAIMGITAGAHRLWSHRSYKAKWPLRFVLMLLQTTSYQ
NHIYEWVRDHRAHHKFTDTDADPHNSRRGFFFSHIGWLMVRKHPDIFTKGATIDLSDLEK
DPIVVWQRRLYIVLMPLLCFVIPTWVPYYFWNEKFIYSWYSNLARYVFSLNVTWMVNSAA
HIWGMKPYDMNICPVENKIVSIFAYGEGWHNYHHVFPWDYKTSEFGTYNTNFTTAFIDFC
ARLGLAYDLKTVSNEIIRKRAARTGDGSRYDRKEAVHYYNLEDMKWGWGDIDMKPEEIQE
INIYNKSD
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgatattgaataagaaattatttcaacaaaatgttgatcaagaaacatcgaagacggaa
aaagaaaataagcaaaaaaaattaatccaggaattatcgaattccgagctgaaatataaa
tggaatatcgtttggaaaaacgtgattgtatttatctaccttcatcttggaggtatatac
ggattttatctttggattaacggaacgaaggcatatacaattttgtggtcaattttcgta
gaattttttgccattatgggcattacagctggagctcacagattatggtcacatagaagt
tataaagcgaaatggcccttacgcttcgtgttgatgcttcttcaaacaacctcttaccag
aatcacatttatgaatgggtaagagatcatagagctcatcacaaattcactgatactgat
gcggatcctcataattcccgacgaggattttttttctctcacataggctggttaatggtc
cgaaagcatccggatatatttacaaaaggtgccactattgacttaagtgatttggaaaaa
gatcccattgtcgtttggcaaagaagattgtatatcgtgctgatgcctcttttgtgcttt
gtaattcctacatgggtaccctattatttttggaatgaaaaatttatatattcctggtac
agcaatttagcaagatatgttttttccttaaacgtaacatggatggtaaactctgctgct
catatatggggcatgaaaccatatgacatgaacatttgtccagtagaaaacaaaattgta
tctatatttgcatacggcgagggatggcataattatcatcatgtatttccgtgggactat
aaaactagtgaatttggtacctataataccaattttactaccgcattcattgatttctgt
gctcgattaggattggcatacgatttgaagactgtttccaatgaaataattagaaaacga
gcagctagaactggagacggatcgagatatgatagaaaggaagctgttcattactacaat
cttgaagatatgaaatggggttggggcgatatagatatgaagcctgaggaaatccaggaa
atcaatatatacaataagagtgattaa

DBGET integrated database retrieval system