KEGG   Apis mellifera (honey bee): 551548Help
Entry
551548            CDS       T01057                                 

Gene name
GB14596
Definition
l-asparaginase-like
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
ame  Apis mellifera (honey bee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG5
AA seq 616 aa AA seqDB search
MLHVENHIDNHKESGMDHLRNNICNSCITTENIRESHVLVLYTGGTIGMIRNENGVLVPK
PNAFVKKLRNYPHMYDREYTEKRFGSMGPLVLPMTATDSRRIIYNVLEYSPLCDSSNMTM
DDWIHIANDIKQSYEYFDGFIVLHGTDTLSYTASALSFMLESLGKIVILTGSQVPIFDSR
SDGLDNFLSSLIIAANHNIPEVCVFFGTNLMRGNRTCKISATSFEAFDSPNFPLLAKANI
NIEVNYRTIFRPCTLEKFYVHTSLNRNVGLIRIFPSMTTDLVKTFLQPPIEGVVLQSYGT
GNVPSNREDIIKELSAATKRGVIIVNITQCSTGHVSNLYEPSKFLSDAGIISGFDMTPEA
ALTKLAYVLSKEEWDMQTKREMMQTNLRGELTAGRPPHLEDLDLVEAVARSLKISSTTEY
QELGSILFPAMLNAAVQSRDVIKLEALKTYGADISQQNADGRTALHIACCEGDLNIVRCL
LRMGANVHIKDRFNRTPLTDAIEFDHHEIIKILMQCGAHLHGNACIIGEKMCIAATTGNV
KRLKSYQLANAILSQKDFSGRTPLHFAALHNRTQVIKFLMEYNVDMICFDKMNQSPYDLA
IAAGSTEAAILLSPPK
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgttgcacgtggaaaatcatattgataatcataaggaaagtggaatggatcacttgaga
aataacatttgtaatagttgtataaccactgaaaatattcgtgaaagtcatgtgcttgtt
ctttatactggcggtactattggcatgattagaaatgaaaatggagttcttgtacctaaa
ccaaacgcttttgtgaagaaattacggaattatccacatatgtacgatcgagaatatacg
gaaaaacgatttggatcgatgggaccgctggtacttccaatgactgcaacagatagtaga
cgtatcatttataatgtgttagaatattcaccactctgcgattctagtaacatgactatg
gatgattggatacacattgctaatgatattaagcaatcttatgaatattttgatggattc
atcgttctacatggaacagacacattaagttatacagcatctgctttatcttttatgctt
gaatctctgggtaaaatagttattttaactggttctcaagttccaatttttgacagcaga
agcgatggtttggacaatttcctctcgtctctaataatagctgcaaatcataacataccg
gaagtatgcgtgtttttcggaacgaatttgatgagaggaaatcgtacttgcaaaatatcg
gccacttcattcgaagcgttcgattcaccgaatttcccacttttggccaaggccaacatc
aatatagaagtgaattatcgaacaatatttcgaccatgtacattagaaaaattttatgta
catacatccttgaatagaaatgttggattgattcgaatatttccaagtatgactacggat
ttggtaaaaacatttttacaacctcctattgaaggtgttgtgttgcaatcctatggaaca
ggaaatgttccttctaatcgagaagatataatcaaagaattatccgcagctacaaaacgc
ggagttatcattgttaatattacacaatgttcaacgggtcatgtttcaaatttgtatgaa
ccttccaaatttctttctgatgctggtataatatcaggtttcgatatgacacctgaagct
gcattgactaaactcgcttacgtactatcaaaggaggaatgggatatgcaaacgaaacgc
gaaatgatgcaaacgaatctacgcggagaattaactgcaggacgacctccacacctcgaa
gatttggatctagtggaggcggttgcaagatctttaaaaatctcctcgacgacagaatat
caagaattgggatcaattctttttcctgcgatgttaaatgccgccgtgcaaagtcgcgac
gtaataaaactcgaagccttgaaaacatatggtgcagatatttcgcaacaaaacgcagat
ggtcgcacagctttgcatattgcttgctgcgaaggtgatttaaatattgttcgctgcctt
ttacgaatgggtgcaaacgttcacatcaaagatcgatttaatcgcacccctcttaccgat
gcgatagaatttgatcatcatgagattattaaaattctaatgcaatgcggcgcacattta
cacggaaacgcatgcataataggagagaaaatgtgtattgcggcaaccactggaaacgtg
aaacgtttaaaatcatatcaattggcaaacgccatactctcgcagaaagatttttctgga
agaaccccattgcacttcgcggcacttcataatagaacacaagttatcaaattcttaatg
gaatacaacgtagacatgatatgttttgataaaatgaatcaatcgccatatgacctcgcc
atagcagctggttccacagaagcagcgatattgttatctcctcctaaatga

DBGET integrated database retrieval system