KEGG   Apis mellifera (honey bee): 551548Help
Entry
551548            CDS       T01057                                 

Gene name
GB14596
Definition
l-asparaginase-like
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     551548 (GB14596)
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     551548 (GB14596)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     551548 (GB14596)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG5
AA seq 616 aa AA seqDB search
MLHVENHIDNHKESGMDHLRNNICNSCITTENIRESHVLVLYTGGTIGMIRNENGVLVPK
PNAFVKKLRNYPHMYDREYTEKRFGSMGPLVLPMTATDSRRIIYNVLEYSPLCDSSNMTM
DDWIHIANDIKQSYEYFDGFIVLHGTDTLSYTASALSFMLESLGKIVILTGSQVPIFDSR
SDGLDNFLSSLIIAANHNIPEVCVFFGTNLMRGNRTCKISATSFEAFDSPNFPLLAKANI
NIEVNYRTIFRPCTLEKFYVHTSLNRNVGLIRIFPSMTTDLVKTFLQPPIEGVVLQSYGT
GNVPSNREDIIKELSAATKRGVIIVNITQCSTGHVSNLYEPSKFLSDAGIISGFDMTPEA
ALTKLAYVLSKEEWDMQTKREMMQTNLRGELTAGRPPHLEDLDLVEAVARSLKISSTTEY
QELGSILFPAMLNAAVQSRDVIKLEALKTYGADISQQNADGRTALHIACCEGDLNIVRCL
LRMGANVHIKDRFNRTPLTDAIEFDHHEIIKILMQCGAHLHGNACIIGEKMCIAATTGNV
KRLKSYQLANAILSQKDFSGRTPLHFAALHNRTQVIKFLMEYNVDMICFDKMNQSPYDLA
IAAGSTEAAILLSPPK
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgttgcacgtggaaaatcatattgataatcataaggaaagtggaatggatcacttgaga
aataacatttgtaatagttgtataaccactgaaaatattcgtgaaagtcatgtgcttgtt
ctttatactggcggtactattggcatgattagaaatgaaaatggagttcttgtacctaaa
ccaaacgcttttgtgaagaaattacggaattatccacatatgtacgatcgagaatatacg
gaaaaacgatttggatcgatgggaccgctggtacttccaatgactgcaacagatagtaga
cgtatcatttataatgtgttagaatattcaccactctgcgattctagtaacatgactatg
gatgattggatacacattgctaatgatattaagcaatcttatgaatattttgatggattc
atcgttctacatggaacagacacattaagttatacagcatctgctttatcttttatgctt
gaatctctgggtaaaatagttattttaactggttctcaagttccaatttttgacagcaga
agcgatggtttggacaatttcctctcgtctctaataatagctgcaaatcataacataccg
gaagtatgcgtgtttttcggaacgaatttgatgagaggaaatcgtacttgcaaaatatcg
gccacttcattcgaagcgttcgattcaccgaatttcccacttttggccaaggccaacatc
aatatagaagtgaattatcgaacaatatttcgaccatgtacattagaaaaattttatgta
catacatccttgaatagaaatgttggattgattcgaatatttccaagtatgactacggat
ttggtaaaaacatttttacaacctcctattgaaggtgttgtgttgcaatcctatggaaca
ggaaatgttccttctaatcgagaagatataatcaaagaattatccgcagctacaaaacgc
ggagttatcattgttaatattacacaatgttcaacgggtcatgtttcaaatttgtatgaa
ccttccaaatttctttctgatgctggtataatatcaggtttcgatatgacacctgaagct
gcattgactaaactcgcttacgtactatcaaaggaggaatgggatatgcaaacgaaacgc
gaaatgatgcaaacgaatctacgcggagaattaactgcaggacgacctccacacctcgaa
gatttggatctagtggaggcggttgcaagatctttaaaaatctcctcgacgacagaatat
caagaattgggatcaattctttttcctgcgatgttaaatgccgccgtgcaaagtcgcgac
gtaataaaactcgaagccttgaaaacatatggtgcagatatttcgcaacaaaacgcagat
ggtcgcacagctttgcatattgcttgctgcgaaggtgatttaaatattgttcgctgcctt
ttacgaatgggtgcaaacgttcacatcaaagatcgatttaatcgcacccctcttaccgat
gcgatagaatttgatcatcatgagattattaaaattctaatgcaatgcggcgcacattta
cacggaaacgcatgcataataggagagaaaatgtgtattgcggcaaccactggaaacgtg
aaacgtttaaaatcatatcaattggcaaacgccatactctcgcagaaagatttttctgga
agaaccccattgcacttcgcggcacttcataatagaacacaagttatcaaattcttaatg
gaatacaacgtagacatgatatgttttgataaaatgaatcaatcgccatatgacctcgcc
atagcagctggttccacagaagcagcgatattgttatctcctcctaaatga

DBGET integrated database retrieval system