KEGG   Apis mellifera (honey bee): 551631Help
Entry
551631            CDS       T01057                                 

Gene name
GB19366
Definition
dihydrolipoamide S-acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ame  Apis mellifera (honey bee)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    551631 (GB19366)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    551631 (GB19366)
   00020 Citrate cycle (TCA cycle)
    551631 (GB19366)
   00620 Pyruvate metabolism
    551631 (GB19366)
Enzymes [BR:ame01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     551631 (GB19366)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG6
AA seq 622 aa AA seqDB search
MAQMMIPRIGLLSIKNNSRVVPRIFVPLKYQRLCFHTSWVFDVQGKSILMPSLSPTMEKG
TIVKWIKKEGDKIEAGDAVADIQTDKAVVTLELEDESILAKIIVGEGIQDIKVGTLIALT
VDVDEDWKSVEMPDNVSVTPPVTASSTSPPSSSASPLSSTPPPSSPPASSSSSPSPPSMP
VQGPPGQTNIGMPALSPTMTSGTIVKWLKKEGEKIEPGDAVAEIQTDKAVMTFEIEDEGI
FAKILIPEGSQAEVGELIAITVEKGMDWKNVVVPTTTKPTAPSGVTPEVVPVGVPTAPPV
GVPAPSVATPSAPSGQVYGLAVRRLLEEYGLKSEEIKGTGRPNRLLKSDVLTYIQTKNIK
KVAPKTAPPPKDQKQPDIPLKKHVPSGGPSTYQDIPVSNIRSIIAKRLGESKITIPHSYA
TIDIKIDKINEIRKELKADGINISINDFITKATAHALVECPFINTLYKNDQIIQMPRVDI
SIAVAIESGLITPIVFDATAKSILDISKNIKELAEKAKTGQLKPEEFQGGTFTISNLGMF
GIKHFRAIINLPQTAILAVGSGREELNAALQKVTKMSTSLSYDRRAIDEDQAADFLAVLK
AMLEDPSFLIAGRLRALRYAQD
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaatgatgatacctaggattggacttttatccattaaaaataatagtcgtgta
gtacctcgaattttcgtgccgttaaaatatcaacgattatgtttccatacaagttgggtt
ttcgatgtccaaggaaagagtattttaatgccttccttgtcacctactatggaaaagggt
accattgtgaaatggatcaagaaagaaggtgataagattgaagcaggagatgcggttgct
gatattcaaactgataaagcagttgttactttggaattagaagatgagagtattcttgca
aaaatcattgtaggagaaggaattcaagatattaaagtaggaacattaatagcacttaca
gttgatgtagatgaagattggaaatctgtagaaatgccagataatgtttcagttacacca
cctgtaactgcatcttcaactagtcctccatcatcatcagcatctccattatcatcaaca
cctcctccatcatcacctccagcatcttcatcatcatcaccatctcctccaagtatgcca
gttcaaggacctcctggacaaacaaatattggtatgccagcgctttcaccaacaatgact
tcaggtacgatagtaaaatggcttaaaaaagaaggagaaaaaatagaacctggcgatgca
gtggctgaaattcaaacagacaaagctgttatgacttttgaaatcgaggatgaaggcata
tttgcaaaaatacttattcctgaaggaagtcaagcagaagtaggagaattaattgccatt
acagtagaaaagggaatggattggaaaaatgttgtagttccaacaacaacaaaacctact
gctccttctggagttactcctgaagttgttcctgtaggtgttccaactgctcctcctgta
ggtgttccagctccttctgttgctactccatctgcaccaagtggacaagtatatggtctt
gctgtaagacgattattggaggaatatggattgaaatcagaagaaattaaaggtactggt
cgacctaatcgattattaaaaagtgatgttttaacttatattcaaacaaagaatataaaa
aaagttgcaccaaaaacagcacctccacctaaagatcaaaagcaacctgatattccttta
aagaaacatgtacccagtggtggtccctccacttatcaagatattccagtttctaatata
cgcagtatcattgctaaaagacttggagaatcaaaaataactatcccgcattcttatgcg
actatcgatattaaaattgataaaataaatgaaattcgtaaggaactcaaggctgatggt
attaatatttcgataaatgatttcattacaaaagcaactgcacatgcactagttgaatgt
ccatttataaatacattatataaaaatgatcaaataattcaaatgccaagagttgatatt
tctatcgcagttgctattgaatcaggacttattacgccaattgtttttgatgctacagct
aaaagtatattggatatttcgaaaaatataaaggaattagctgaaaaagctaaaactggt
caattaaaaccggaagaattccaaggaggaacattcacaatatccaatttgggaatgttt
ggtattaagcatttcagagccattataaatcttcctcaaacagcaatattagcagttgga
agtggtcgagaagaactaaatgctgcattacaaaaagtaacaaaaatgtcaacatcttta
tcgtatgatagacgagcaattgatgaagatcaagcagctgactttttagctgttttaaaa
gctatgttggaagacccatcttttcttattgcaggaagattacgagcactaaggtacgca
caggactga

DBGET integrated database retrieval system