KEGG   Apis mellifera (honey bee): 551631Help
Entry
551631            CDS       T01057                                 

Gene name
GB19366
Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial-like
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00010  Glycolysis / Gluconeogenesis
ame00020  Citrate cycle (TCA cycle)
ame00620  Pyruvate metabolism
ame01100  Metabolic pathways
ame01200  Carbon metabolism
Module
ame_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    551631 (GB19366)
   00020 Citrate cycle (TCA cycle)
    551631 (GB19366)
   00620 Pyruvate metabolism
    551631 (GB19366)
Enzymes [BR:ame01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     551631 (GB19366)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_3 Biotin_lipoyl_2 QRPTase_N PEP-utilisers_N
Motif
Other DBs
NCBI-GeneID: 551631
NCBI-ProteinID: XP_624025
BEEBASE: GB53566
UniProt: A0A088APL2
Position
LG6
AA seq 622 aa AA seqDB search
MAQMMIPRIGLLSIKNNSRVVPRIFVPLKYQRLCFHTSWVFDVQGKSILMPSLSPTMEKG
TIVKWIKKEGDKIEAGDAVADIQTDKAVVTLELEDESILAKIIVGEGIQDIKVGTLIALT
VDVDEDWKSVEMPDNVSVTPPVTASSTSPPSSSASPLSSTPPPSSPPASSSSSPSPPSMP
VQGPPGQTNIGMPALSPTMTSGTIVKWLKKEGEKIEPGDAVAEIQTDKAVMTFEIEDEGI
FAKILIPEGSQAEVGELIAITVEKGMDWKNVVVPTTTKPTAPSGVTPEVVPVGVPTAPPV
GVPAPSVATPSAPSGQVYGLAVRRLLEEYGLKSEEIKGTGRPNRLLKSDVLTYIQTKNIK
KVAPKTAPPPKDQKQPDIPLKKHVPSGGPSTYQDIPVSNIRSIIAKRLGESKITIPHSYA
TIDIKIDKINEIRKELKADGINISINDFITKATAHALVECPFINTLYKNDQIIQMPRVDI
SIAVAIESGLITPIVFDATAKSILDISKNIKELAEKAKTGQLKPEEFQGGTFTISNLGMF
GIKHFRAIINLPQTAILAVGSGREELNAALQKVTKMSTSLSYDRRAIDEDQAADFLAVLK
AMLEDPSFLIAGRLRALRYAQD
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaatgatgatacctaggattggacttttatccattaaaaataatagtcgtgta
gtacctcgaattttcgtgccgttaaaatatcaacgattatgtttccatacaagttgggtt
ttcgatgtccaaggaaagagtattttaatgccttccttgtcacctactatggaaaagggt
accattgtgaaatggatcaagaaagaaggtgataagattgaagcaggagatgcggttgct
gatattcaaactgataaagcagttgttactttggaattagaagatgagagtattcttgca
aaaatcattgtaggagaaggaattcaagatattaaagtaggaacattaatagcacttaca
gttgatgtagatgaagattggaaatctgtagaaatgccagataatgtttcagttacacca
cctgtaactgcatcttcaactagtcctccatcatcatcagcatctccattatcatcaaca
cctcctccatcatcacctccagcatcttcatcatcatcaccatctcctccaagtatgcca
gttcaaggacctcctggacaaacaaatattggtatgccagcgctttcaccaacaatgact
tcaggtacgatagtaaaatggcttaaaaaagaaggagaaaaaatagaacctggcgatgca
gtggctgaaattcaaacagacaaagctgttatgacttttgaaatcgaggatgaaggcata
tttgcaaaaatacttattcctgaaggaagtcaagcagaagtaggagaattaattgccatt
acagtagaaaagggaatggattggaaaaatgttgtagttccaacaacaacaaaacctact
gctccttctggagttactcctgaagttgttcctgtaggtgttccaactgctcctcctgta
ggtgttccagctccttctgttgctactccatctgcaccaagtggacaagtatatggtctt
gctgtaagacgattattggaggaatatggattgaaatcagaagaaattaaaggtactggt
cgacctaatcgattattaaaaagtgatgttttaacttatattcaaacaaagaatataaaa
aaagttgcaccaaaaacagcacctccacctaaagatcaaaagcaacctgatattccttta
aagaaacatgtacccagtggtggtccctccacttatcaagatattccagtttctaatata
cgcagtatcattgctaaaagacttggagaatcaaaaataactatcccgcattcttatgcg
actatcgatattaaaattgataaaataaatgaaattcgtaaggaactcaaggctgatggt
attaatatttcgataaatgatttcattacaaaagcaactgcacatgcactagttgaatgt
ccatttataaatacattatataaaaatgatcaaataattcaaatgccaagagttgatatt
tctatcgcagttgctattgaatcaggacttattacgccaattgtttttgatgctacagct
aaaagtatattggatatttcgaaaaatataaaggaattagctgaaaaagctaaaactggt
caattaaaaccggaagaattccaaggaggaacattcacaatatccaatttgggaatgttt
ggtattaagcatttcagagccattataaatcttcctcaaacagcaatattagcagttgga
agtggtcgagaagaactaaatgctgcattacaaaaagtaacaaaaatgtcaacatcttta
tcgtatgatagacgagcaattgatgaagatcaagcagctgactttttagctgttttaaaa
gctatgttggaagacccatcttttcttattgcaggaagattacgagcactaaggtacgca
caggactga

DBGET integrated database retrieval system