KEGG   Apis mellifera (honey bee): 551668Help
Entry
551668            CDS       T01057                                 

Gene name
RPTOR, GB11644
Definition
regulatory associated protein of MTOR, complex 1
Orthology
K07204  
regulatory associated protein of mTOR
Organism
ame  Apis mellifera (honey bee)
Pathway
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:ame04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
Un
AA seq 1288 aa AA seqDB search
MMSVITSKSCHEEENLKSTEEDDWKIQLAFCKSRHSATIEGVNCITQTWRMKERMKTVSV
ALVLCLNVGVDPPDIVKTQPCARLECWIDPLSVSPQKALETIGSNLQKQYERWQPRARYK
QSLDPTVEEVKKLCTSLRRNAKEERVLFHYNGHGVPKPTSNGEIWVFNRTYTQYIPLSVY
DLQTWMGAPSIYVYDCSNAGIIVESFQQFAEQHEKEYEMEKQAVQQNRASGVAGTSTPSY
KNCIQLAACAASQILPMNPDLPADIFTSCLTTPIKIALRWFVMQNTSKLVPKISLDLIDK
IPGQLTDRRTMLGELNWIFTAITDTIAWNTLPRDLFQRLFRQDLLVASLFRNFLLAERIL
RSYDCTPVSCPKLPPTYQHPMWQAWDLALDLCLAQLPSILENEDQFVHSPFFEEQLTAFQ
VWLTLGSKNRNPPEQLPIVLQVLLSQVHRLRALELLGRFLDLGPWAVNLALSVGIFPYVL
KLLQSNARELRPLLVFIWAKILAVDSTCQADLVRDGGHKYFLSVLQDTSIPSEHRTLAAF
VLASIVNDYRPGQIAANHGSLVSICLEQLGDLNALLRQWLCLCLARLWHNYDKARWCGVR
DIAHEKLFTLLQDPVPEVRAASVYALGTFINSVTTRSEHANNIDQIIAMTLINTVSYDMC
PLVRKELVVALQWMVLHFENSFVTLALAEENSRKDLVVETLSPFSGMRRISSRDRLKMLS
PNNTYNPESTEGFGQDRIKRVSSSSSISSLGNNWEFVRKPCESLGHSSLGNLPSLSYGSV
YMKLWHGLCSLDNDPHPVVATMSQKVTNHIRNQVKESSTPKEVIETKISSSLSLPPSPSN
RTTYLSNSKGDSPPTVNSGTDLLRSSRIPSHSNRSRKPIPNTISEEADEVAGIKTPLTTS
QFVEWSCAQFAQPVSLETEIESMNDMESRIHYEREWRYLRNKRQRREAREEQLRAIQSRV
EFQVFHTRCSHSPEVLTFHPFEPHLAVALKDFFGVWDCQTGAKLTYCASHGNKMSRITAL
EFINAHDVTLLMAGSDDGSVRVWKNYSSMLNRDPVLLTAWQAMADIQPAAKTTTATAGLV
TKWEQKSLTLAVTGDVRIVRLWDAETELKKQDIPTGADCCATCIDVDGVGAMMAVGCGDG
SVRLFDRRLPPLESRVMIWREHTAWVLGTSLRKCERSTPQLFTGSSSGDIRIFDLRKNSS
VSTVQITQGITALAAHEMTDIFACGSTNHCISVYNTMGQHLNTIKFHEGFMATRISPVSC
LSFHPYRVILAAGLVDSTITAYASEPRR
NT seq 3867 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcagtaattacttctaaatcatgccacgaggaagagaatttgaaatcgacggaa
gaggatgattggaaaatacagcttgcattttgtaaatcacggcatagtgcaacaattgag
ggtgtaaactgtattacacagacatggagaatgaaagaacgaatgaaaactgtgagcgtg
gctctagttttatgtttaaatgttggcgttgatccaccagatattgtcaagacgcaaccg
tgcgcacgtttagagtgttggatcgatcctttatcagtgagtccacagaaagcattagaa
actataggttctaatttacaaaaacagtatgaacgatggcagccaagagctcgttataaa
caaagcttagatcctactgttgaagaagttaaaaaattatgtacatctttaagacgaaat
gcaaaagaagaaagagttctttttcattataatggtcatggtgttcctaaacctactagt
aatggtgaaatatgggtatttaataggacatatacacaatatattcctttgtctgtatat
gatttacaaacatggatgggtgcacctagtatttatgtatatgattgttccaatgcaggt
atcattgtagaatcttttcagcaatttgcagaacaacatgaaaaggaatatgagatggaa
aaacaggcagttcaacaaaatcgtgcaagtggagtagcaggtacctcaacaccatcttac
aaaaattgtattcaattggcagcatgtgcggctagtcagattttgcctatgaatccagat
ttacctgcagatatatttacatcatgtcttacaactccaataaaaattgcattgcgatgg
tttgtaatgcaaaatacatctaaattggtaccaaaaatatcattagatttaattgataaa
attccaggacaattaactgatagaagaacaatgttaggagaacttaattggatttttaca
gcaattactgatactatagcatggaatacattgccaagagatttatttcagagattattc
agacaagatttattagtagctagtttatttagaaattttctacttgctgagcgaatatta
cgttcgtatgattgcactccagtttcttgtccaaaattaccacctacttatcagcatcct
atgtggcaagcatgggatttagcacttgatctttgcttagcacaattaccatctattctt
gagaatgaagatcaatttgtgcattcgccattttttgaagagcaactaactgcttttcaa
gtatggcttacattaggttctaaaaatcgtaatccaccagaacaactgccaatagtttta
caagtattattaagtcaagttcatagacttagagcattggaattattaggacgttttctt
gatcttggtccatgggcagtgaatttggctcttagtgtaggcatttttccatatgtttta
aaattacttcagagtaacgctagagaactacgtccattacttgtatttatatgggcaaaa
attcttgcagttgatagtacttgtcaagcagatttggtacgagatggagggcataaatat
tttttatctgttcttcaagatacttcaataccaagtgaacacagaacattagcagcattt
gttttggctagtattgtgaatgattatcgaccaggtcagattgctgcaaatcatggtagt
cttgtttctatttgtttagaacaacttggagatttgaatgctttattacgacagtggtta
tgtttatgccttgcaagactttggcataattatgacaaagcaagatggtgtggagtcaga
gatattgctcatgagaaattgtttacattattacaagatccagttcctgaggtccgagca
gctagtgtttatgctttgggaacatttataaacagtgtaacaacacgaagtgagcatgcg
aataatattgatcaaatcatagctatgactcttattaatactgtatcttatgatatgtgt
cctttagttagaaaagaattagtagtagcacttcaatggatggtattacattttgaaaat
tcttttgtaactttagcattggctgaagaaaatagcagaaaagatttagtagtagagaca
ttatcaccatttagtggaatgagacgtattagttctagagatagactaaaaatgctttct
ccaaataatacatataatccagagagtacagaaggatttggacaggatcgtattaaaaga
gtgtcatcatcatcatctattagtagtttaggaaataattgggagttcgtgaggaaacct
tgcgagtcacttggacacagttctcttggaaatttaccaagtctttcttatggtagtgtg
tatatgaaattatggcatggattatgtagtcttgataatgatcctcatcctgtggttgct
actatgtctcaaaaagtcactaatcacattcgaaatcaggtcaaagaatcttctacacct
aaggaagtaattgaaacaaaaatatcttcatcactatctcttccaccttctccatcaaat
cgtactacatatttaagtaatagcaaaggagactcaccgcctactgtaaactctggaact
gatctattacgttcatcaagaataccatcacatagtaatcgttcaagaaaaccaattcct
aatacaatatcagaagaagcagatgaagttgctggaataaaaacaccattaacaacttca
caatttgttgaatggagttgtgctcaatttgcccagccagttagtttagaaactgaaatt
gaatctatgaatgatatggaaagtagaattcattatgaaagagaatggcggtacttaaga
aataaaagacaaagacgtgaagcaagagaagaacaattacgtgcaatacaaagtagagta
gaatttcaagtatttcatacaaggtgttcacattctccggaagttttaacatttcatcct
tttgaacctcatttggctgtagcattgaaagatttctttggagtatgggattgtcaaact
ggtgcaaaattgacttattgtgcaagtcatggtaataaaatgtcacgtattacagcacta
gaatttattaatgctcatgatgtgactttattaatggctggttctgatgatggttcagtt
agagtatggaaaaattatagtagtatgctaaatcgcgatccagttttacttactgcttgg
caagcaatggctgatatacaacctgcagcaaaaacaactactgcaacagctggattagtc
actaagtgggagcaaaaatcgcttacattagctgtgacgggcgatgttcgcattgttaga
ctttgggatgcagaaactgaattaaagaaacaagatataccaacgggtgctgattgctgt
gctacatgtattgatgttgatggtgtaggtgcaatgatggcagtaggatgtggagatggt
tcagttcgtttattcgatagaagattgcctccattagaatcaagagttatgatttggagg
gagcatacagcttgggtgttaggtacatctttaagaaaatgtgaaagatctacaccacag
ttgttcactggatcatcttcaggagatattagaatatttgatcttagaaaaaattcttct
gtaagcactgtacagataacacaaggtattacagcattggcagcacatgaaatgactgat
atatttgcgtgtggatcaacaaatcattgtataagtgtgtataacacaatgggacaacat
ttaaacacaataaaatttcatgaaggatttatggctactcgtattagtcctgtaagttgt
ttgagttttcatccttatcgtgtaattctagcagctgggttggtagacagtactattaca
gcatatgcatctgaaccacgtagatga

DBGET integrated database retrieval system