KEGG   Apis mellifera (honey bee): 551687Help
Entry
551687            CDS       T01057                                 

Gene name
GB18702
Definition
alkaline phosphatase 4-like
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ame  Apis mellifera (honey bee)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ame00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG2
AA seq 543 aa AA seqDB search
MKRVLLLSICSLMGFLQFANPLPRNATEYEDMSYWLKSGQENLRRILAHRNNENRAKNII
IFIGDGMGISTITAGRIYKGQIKGNTGEEYKLAFEMFPNAGFAKTYNTDKQVPDSAGTAT
AIFSGVKCRYKVIGLDTRSSFNKCDKYIDQASKLTTVADWAQQSGMGTGFVTTTRVTHAT
PAGLYAHVNNRDWECDTSIPKQYKDCVKDIGRQLMEDEPGNKFQVIMGGGAQHLGLPMEP
IDPDTCVRGDGKNLVEYWEGNNPDGKVVTNTEQLFSVDIANTSKILGIFATNHLPYHAVK
TESTPSLANMTKQAIKLLRKNDNGFLLMVESGRIDMAHHHNYAKLALRELSELEEAILAA
LQLVKLEETLVIVTADHSHAFTINGYPKRGNDILGFANDPAKPNVPAYETLSYINGPGFF
YHRRNDSSNVNETWRPVDLDQTRNDPYYTQMAGIYLEDETHGGEDVGVYAIGPYSHLIRG
TFEQNYIAHVVAYAACFKDWPSHCDNVYNRYFYQLTNSVNRNTDSSIVSLLMLLLLSTLV
NRY
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgagtactcttattatcaatctgttcactgatgggatttctccagtttgccaac
cctctacctcgaaacgcgaccgaatacgaagatatgtcctattggctaaaatctggccaa
gagaatcttcgaaggatcctagctcatcgtaataacgaaaatcgcgcgaagaacattatt
attttcatcggtgacgggatgggaatttctacgatcacggctggtcgaatctacaaaggc
caaatcaagggtaacaccggcgaagaatacaaattggcgttcgaaatgtttcccaacgct
ggattcgccaagacttacaacacggacaagcaagttcccgattcggctggaacagctacc
gcgatattttccggcgtgaaatgtcgttacaaggttatcggcttggacacgagatcttcg
ttcaataaatgcgacaagtacatcgatcaagcgagcaaacttacaaccgtcgccgattgg
gctcaacaaagtggcatgggcacgggattcgtaaccacgactcgggtcacccatgccact
ccggcaggattgtacgctcacgtgaacaatcgcgactgggaatgcgacacctcgataccg
aaacaatacaaggattgcgtgaaggatataggaagacagttgatggaggatgaaccggga
aacaagtttcaggtaataatgggcggtggagcgcaacacttaggtttacctatggaaccg
atagatcccgatacgtgcgtcaggggagatgggaaaaatttggtggagtattgggaggga
aacaaccctgacgggaaagtggtaaccaacaccgaacaactcttctccgtcgatatcgcc
aacacgtcgaaaattcttggaatcttcgccaccaatcacctcccctatcacgccgtcaaa
accgaaagtacgccaagtttggccaatatgaccaaacaagctatcaaactgctccggaag
aacgacaatggtttccttctgatggtcgagagcggaagaatagacatggcccatcatcac
aattacgcaaagttagcattgcgagagttatcggaactcgaggaggcgatattggccgcc
cttcaactggtcaagttggaagaaacattggtgatcgtgactgccgaccattcccacgcg
ttcaccattaacggttacccgaagagagggaacgacatcctcggtttcgccaacgatcca
gccaagccgaacgtgcctgcctacgagacgctcagttacatcaacggtccaggcttcttc
tatcatcgacgaaacgacagtagcaacgttaacgaaacgtggaggcccgtcgatctggat
cagacgcgcaatgatccctactacactcaaatggctgggatatatttggaggacgagacg
cacggaggcgaagatgtcggagtttacgcgataggtccgtattcccacttgattcgcggt
acttttgaacaaaattatatcgcccacgtagtggcgtatgcggcgtgcttcaaagactgg
ccttcccattgtgacaacgtttacaatcgttacttctaccaactgaccaactcggtgaat
cgtaataccgattcatccattgtatctctcttgatgttgctgcttctctcgacgctggtc
aatcgttattga

DBGET integrated database retrieval system