KEGG   Apis mellifera (honey bee): 551709Help
Entry
551709            CDS       T01057                                 

Gene name
sl, GB14618
Definition
small wing
Orthology
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
ame  Apis mellifera (honey bee)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    551709 (sl)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    551709 (sl)
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     551709 (sl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG14
AA seq 1136 aa AA seqDB search
MYMVEIREIKEIKIGKHSKDFEKWPEDAKRIENLRCFVVYYGSEFRLKTLSISALSEKEC
ELWVKGLRRLVQDTIKAPYPLQVERWLRKEFYAMENSRETVTLKDIKAFLPRVNCKIATN
KLRELFQEIDTRNRNELGFDDFVILYHKFIFDQNNLTDWSKLLNYSKTGQIVTVQEFQNF
LITEQQDPLGNNEVEVSCFIRDYLQDPQRDVQEPHFTFSEFIDFLFSKQNSVWDSKYSRI
YQDMTKSLAHYWIASSHNTYLMGDQISSESSCQAYVRALRTGCRCIELDCWDGPDGMPFI
FHGHTLTTKIKFLDVIKTIKEHAFATSDYPVILSIEDNCTLPQQRKMAITMQDIFGDMLL
VQPIDKNETCLPSPYALRRKIILKHKKLPDGVDETSFLIRNDESRQEMDLRNTVKNGILY
LEDPVDREWNPHFFVLTQQKLFYTDTFSRTQENEHDDDEETVIRRPTDGVPNDELHFGEK
WFHGKLARGREEAEELLRRYSHLSDGTFLVRQCVTFVGDYCLSFWRKGKVNHCRIKLKQE
MGQTQYYLIDTNCFDSLYSLITYYRSHPLRSQEFLITLQEPVPQPNKHEEKEWWHAECTR
TLAEEMLKRIPTDGAFLVRPSEKENNSYAISFRAENKIKHCRIKLEGRLYTIGTVQFESL
VELVNYYERHPLYKKIKLSHPVNEDVIRKIELDIDDGSVYGIPGYMDPTSFTSKVTVKAI
YDYKARRDDELTLVKHAIITNVHRQSGGWWRGDYGGKKQHWFPASYVEEIKPQDNQGDSA
DSMMFGSLQKGSLDIMGAVVELRVGGRPDLKWILRIQNPSMCSVFEVATSSEDTALEWMS
SIKETAQNASVRENQHKEMERAWRIAKEMSNLIVYCRSVAFNLDRIKTKGFTFNEMSSFP
ETKAEKLMCQQENKFFIKYHQIQFSRVYPKGQRIDSSNYNPVPMWNAGCQMVALNYQTGD
KSMQLNQAKFKENGNCGYILKPEFMFRDDFNPYDKNCLYGVESLKFILKVIGARHLIRSG
RGIASPFVEIEIIGADFDSGTKLTTRTIPDNGFNPMWNESCEFEVFNPYFAFIRFVVQDE
DMFGDSNFIGQATYPVRCLRSGYRSVPLQNNYSEDLELASLLIHLRIISSVHSHNL
NT seq 3411 nt NT seq  +upstreamnt  +downstreamnt
atgtatatggttgaaataagagaaatcaaagaaattaaaataggaaaacattctaaagat
tttgaaaaatggccagaagatgcaaaaagaattgaaaatcttagatgttttgttgtatat
tatggttccgaatttcgtcttaaaactctttcaatttctgctcttagtgaaaaagaatgt
gaactttgggtaaaaggattacgtcgcttggttcaagatactataaaagctccttatcct
ttacaagtggaaagatggctaagaaaagaattttatgcaatggaaaattcaagagaaacg
gttactttaaaagatataaaagcatttttacccagagttaattgtaagatagcaacaaat
aaactcagagaactttttcaagaaatagatacaagaaatagaaatgaacttggttttgat
gattttgttatactttatcataaatttatctttgatcaaaataatcttacagattggagt
aaattacttaattattctaaaacgggacaaattgtgaccgttcaagaattccaaaatttt
ttaataactgaacaacaagatcctttaggaaataatgaagttgaagtatcatgttttatt
agagattatttacaagatcctcaaagagatgtacaagaaccgcattttacattttcggaa
tttattgattttttattttcaaaacaaaattctgtttgggattcaaaatactcgcgaatt
tatcaagatatgaccaaatctcttgcgcattattggatagcatcatcacataatacatat
ttaatgggagatcaaattagcagtgaaagtagttgccaagcttatgttcgtgcattaaga
actggatgtagatgtatagaacttgattgttgggatggaccagatggaatgccctttatt
tttcatggacacacactaactacaaaaattaaatttttagatgttataaaaactattaaa
gaacacgcttttgctacttctgattatcctgtcattttatctattgaagacaattgtact
ttacctcaacaacgtaaaatggcaattacaatgcaagatatatttggtgatatgttatta
gttcaacctatagataaaaatgaaacttgtttaccatcaccatatgcattgagaagaaaa
attatattgaaacataaaaaattacctgatggcgttgacgaaacatcatttcttattcga
aatgatgaaagtagacaagaaatggatcttagaaatacagttaaaaatggcattttatat
cttgaagatcctgttgatagagaatggaatccacatttttttgtattaacacaacaaaaa
ttattttatacagatacattttctagaacccaagaaaatgaacacgatgatgatgaagaa
actgtaattcggcgaccaactgatggagtaccaaatgatgaattacattttggagaaaaa
tggtttcatggtaaattagcaagaggaagagaagaagcagaagaattattacgacgttat
tcacatcttagcgatggaacatttttagttcgacaatgcgttacatttgtaggtgattat
tgtctttctttttggcgcaaaggcaaagtaaatcattgtcgtattaaactcaaacaagaa
atgggacaaacgcaatattatcttattgatacaaattgttttgatagtttgtatagttta
attacatattaccgcagtcatccattaagaagtcaagaatttttaatcacacttcaagaa
ccagttccgcaaccaaataaacatgaagaaaaagaatggtggcatgcagaatgtactcga
actttagctgaagaaatgttaaaacgaattcctacagatggtgcatttttagtaagacca
agtgaaaaagaaaataattcttatgctatatcttttagagcagaaaataaaattaagcat
tgcagaattaaattagaaggacgtctgtatactattggtactgtacaatttgaaagtttg
gttgaattagttaattattatgaaagacatccattatataaaaaaatcaaattaagtcat
cctgtaaatgaagatgttattagaaaaatagaactggatatagatgatgggtctgtttat
ggtattcctggttatatggatcctactagttttacttcgaaagtaactgtaaaagctata
tatgattataaagcaagaagggatgatgaattaacattagtaaaacatgctataataaca
aacgtacatcgacaaagtggtggttggtggcgaggagattatggtggtaaaaaacaacat
tggtttcctgctagttatgtagaagaaataaaaccacaagataatcaaggagattcagca
gattctatgatgtttggtagtctacagaaaggttcattagatattatgggtgctgttgtt
gaattaagagtaggaggaagacctgatttaaaatggatattaagaatacaaaatcctagt
atgtgttcagtatttgaagtagcaacttcttcagaagatacagcattagaatggatgtcc
agtattaaagaaactgctcaaaatgccagtgttagagagaatcaacataaagaaatggaa
cgtgcatggagaattgctaaagaaatgtctaatctaatagtttactgcagatctgttgca
ttcaatttagatagaataaaaacaaaaggttttacatttaatgaaatgagtagctttcct
gaaactaaagctgaaaaacttatgtgtcaacaagaaaacaaattttttataaaatatcat
cagattcaatttagtagagtatatcctaaaggacaacgaattgattcatcaaattataat
cccgtaccaatgtggaatgctggttgtcagatggtagcattgaattatcaaactggtgat
aaatcaatgcaacttaatcaagccaaatttaaagaaaatgggaattgtggttacatttta
aaaccggaatttatgtttagagatgattttaatccatatgataaaaattgtttatatgga
gtagaatcacttaagtttattttaaaagttattggtgcaaggcatttaattcgatcagga
agaggtatagctagtccttttgttgaaattgaaataataggagcagattttgattctggt
acaaaattaacaacaagaacaatacctgataatggattcaatcctatgtggaatgaatct
tgtgaatttgaagtttttaatccatatttcgcattcatacgatttgttgtgcaagatgaa
gatatgtttggtgatagtaattttattggacaagccacttatcctgtgcgatgtctacga
tcaggatatagaagtgttccattacaaaataattatagtgaagatcttgaactcgcatca
ttattaatacatcttcgaattatatcttcagtacattctcataatttgtaa

DBGET integrated database retrieval system