KEGG   Apis mellifera (honey bee): 551839Help
Entry
551839            CDS       T01057                                 

Gene name
GB19130
Definition
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase-like
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ame  Apis mellifera (honey bee)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    551839 (GB19130)
Enzymes [BR:ame01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     551839 (GB19130)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     551839 (GB19130)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG15
AA seq 166 aa AA seqDB search
MVRAWYMDNSNIDQRLEHHKQPPEYISIENLFKITELKKKRGYTYEDEIECSKKCLPNYE
EKLKNFFTEHLHTDEEIRLILDGSGYFDVRDKHDQWIRIEVQAGDLIIIPSGIYHRFTLD
INNYIKAKRYFVGEPVWLPYNRPADDMECRKNYLNRLNHGFEVEIF
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggttcgtgcgtggtacatggataatagtaatattgatcaacgattagaacatcataaa
caaccacctgaatatatttctattgagaatttattcaagataacagaattaaagaaaaaa
cgtggttatacatacgaagatgaaatagaatgttccaaaaaatgccttccaaattatgaa
gagaaattaaaaaatttttttactgagcatcttcatactgatgaagaaataaggttaatc
ttagatggatcaggatattttgatgttcgagataaacatgatcaatggatacgtattgaa
gttcaagctggagatttaataattattcctagtggaatatatcacagatttactttggat
attaacaattatataaaagcaaaacgttattttgtcggagagcctgtttggttgccttac
aacagaccagctgatgatatggaatgtcgtaaaaattacttaaatcgtttgaaccatggt
tttgaagtggaaattttttaa

DBGET integrated database retrieval system