KEGG   Apis mellifera (honey bee): 551839Help
Entry
551839            CDS       T01057                                 

Gene name
GB19130
Definition
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase-like
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ame  Apis mellifera (honey bee)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:ame00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG15
AA seq 166 aa AA seqDB search
MVRAWYMDNSNIDQRLEHHKQPPEYISIENLFKITELKKKRGYTYEDEIECSKKCLPNYE
EKLKNFFTEHLHTDEEIRLILDGSGYFDVRDKHDQWIRIEVQAGDLIIIPSGIYHRFTLD
INNYIKAKRYFVGEPVWLPYNRPADDMECRKNYLNRLNHGFEVEIF
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggttcgtgcgtggtacatggataatagtaatattgatcaacgattagaacatcataaa
caaccacctgaatatatttctattgagaatttattcaagataacagaattaaagaaaaaa
cgtggttatacatacgaagatgaaatagaatgttccaaaaaatgccttccaaattatgaa
gagaaattaaaaaatttttttactgagcatcttcatactgatgaagaaataaggttaatc
ttagatggatcaggatattttgatgttcgagataaacatgatcaatggatacgtattgaa
gttcaagctggagatttaataattattcctagtggaatatatcacagatttactttggat
attaacaattatataaaagcaaaacgttattttgtcggagagcctgtttggttgccttac
aacagaccagctgatgatatggaatgtcgtaaaaattacttaaatcgtttgaaccatggt
tttgaagtggaaattttttaa

DBGET integrated database retrieval system