KEGG   Apis mellifera (honey bee): 551901Help
Entry
551901            CDS       T01057                                 

Gene name
eIF-4E, GB18003
Definition
eukaryotic translation initiation factor 4E
Orthology
K03259  
translation initiation factor 4E
Organism
ame  Apis mellifera (honey bee)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:ame00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    551901 (eIF-4E)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    551901 (eIF-4E)
Translation factors [BR:ame03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    551901 (eIF-4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
Un
AA seq 213 aa AA seqDB search
MATSNTEEIEEVERKEQEVVNFDEFPPEVLIKHPLQHTWTLWYYEPDRNKTWEESQRKVT
SFDTAEDFWSLYNHIKAASELKQGCDYSMFKQGIRPMWEDNANKCGGRWLINLDKKQRNT
DLDHFWLETLLCMIGEAFNGYSDDICGAVVNVRQKGDKIGVWTANANSEDSVMEIGRKLR
ERLKIASKVTIGYQIHKDVMVKVGSQTKNAYVV
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggctacgagtaatacagaagaaattgaggaagttgaaagaaaggagcaagaagtagta
aacttcgatgaattccccccagaagttttaatcaaacatccacttcaacatacatggact
ctttggtattatgaaccagatagaaataaaacatgggaagaaagtcaaagaaaagttaca
agttttgatacagctgaagatttctggagtttatataatcatataaaggcagcatcagaa
ttaaaacaaggttgtgactatagcatgttcaaacaaggaatccgacctatgtgggaagat
aatgccaataaatgtggtggaagatggcttataaatttagataaaaagcaaagaaataca
gatttagatcacttttggttagaaactcttttatgtatgattggtgaagcatttaatgga
tattcagatgatatttgtggggctgttgtaaatgtaaggcaaaaaggagataaaattggt
gtatggactgcaaatgctaatagtgaagatagtgttatggaaattggacgtaaattaaga
gaaagattaaaaattgcatccaaagttactataggctatcaaatacataaagatgttatg
gtcaaagtaggaagtcaaacaaaaaatgcttatgttgtttaa

DBGET integrated database retrieval system