KEGG   Apis mellifera (honey bee): 551901Help
Entry
551901            CDS       T01057                                 

Gene name
eIF-4E
Definition
(RefSeq) eukaryotic translation initiation factor 4E-1A
  KO
K03259  
translation initiation factor 4E
Organism
ame  Apis mellifera (honey bee)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:ame00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    551901 (eIF-4E)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    551901 (eIF-4E)
Messenger RNA biogenesis [BR:ame03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     551901 (eIF-4E)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     551901 (eIF-4E)
Translation factors [BR:ame03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    551901 (eIF-4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
BEEBASE: 
UniProt: 
Position
Un
AA seq 213 aa AA seqDB search
MATSNTEEIEEVERKEQEVVNFDEFPPEVLIKHPLQHTWTLWYYEPDRNKTWEESQRKVT
SFDTAEDFWSLYNHIKAASELKQGCDYSMFKQGIRPMWEDNANKCGGRWLINLDKKQRNT
DLDHFWLETLLCMIGEAFNGYSDDICGAVVNVRQKGDKIGVWTANANSEDSVMEIGRKLR
ERLKIASKVTIGYQIHKDVMVKVGSQTKNAYVV
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggctacgagtaatacagaagaaattgaggaagttgaaagaaaggagcaagaagtagta
aacttcgatgaattccccccagaagttttaatcaaacatccacttcaacatacatggact
ctttggtattatgaaccagatagaaataaaacatgggaagaaagtcaaagaaaagttaca
agttttgatacagctgaagatttctggagtttatataatcatataaaggcagcatcagaa
ttaaaacaaggttgtgactatagcatgttcaaacaaggaatccgacctatgtgggaagat
aatgccaataaatgtggtggaagatggcttataaatttagataaaaagcaaagaaataca
gatttagatcacttttggttagaaactcttttatgtatgattggtgaagcatttaatgga
tattcagatgatatttgtggggctgttgtaaatgtaaggcaaaaaggagataaaattggt
gtatggactgcaaatgctaatagtgaagatagtgttatggaaattggacgtaaattaaga
gaaagattaaaaattgcatccaaagttactataggctatcaaatacataaagatgttatg
gtcaaagtaggaagtcaaacaaaaaatgcttatgttgtttaa

DBGET integrated database retrieval system