KEGG   Apis mellifera (honey bee): 552023Help
Entry
552023            CDS       T01057                                 

Gene name
GB17101
Definition
guanylate kinase-like
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ame  Apis mellifera (honey bee)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    552023 (GB17101)
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     552023 (GB17101)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG5
AA seq 215 aa AA seqDB search
MKFTYIHYSKLNFRNIKGVYNMLHKGPRPLVLCGPSGSGKSTLIKKLFEEFPDTFGYSVS
HTTRAPRPGEEDGKHYHFTTKEKMQKQIEQDEFIETAIFSGNMYGTSKCAVEKVQQMGKI
CVLDIEIQGVEQVKRSSLDPLYIFIKPPSIEELEKRLRARKTETEDVLKQRLSIAKVEME
YGEKTGNFDIVIENDNFSKAYNILREFVMSNLKQG
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttacatatattcactatagtaaattaaattttagaaatataaaaggtgtttat
aatatgcttcataaaggtccacgtccattagttttgtgtggtccttcaggaagtggaaaa
agtacattaataaaaaagctttttgaagaatttccagatacttttggttattctgtatct
cataccactagagcccctagaccaggcgaggaagatgggaaacattatcattttactact
aaagaaaaaatgcaaaaacagatagaacaagatgaatttattgaaactgccatatttagt
ggaaatatgtatggcactagtaaatgtgcagtagaaaaagtacagcaaatgggaaaaatt
tgtgtattagatattgaaatacaaggagtagagcaagtaaaacgaagttctttagatccc
ttgtatatatttattaaaccaccatctatagaagaattagagaaaagattaagagctaga
aaaacagaaacagaagatgttttgaaacaaagattgtctattgctaaagtagaaatggaa
tatggtgaaaaaactggtaattttgacatagtgattgaaaacgataatttttcaaaggca
tataatatattaagagaatttgtgatgtcaaatttgaagcaaggataa

DBGET integrated database retrieval system