KEGG   Apis mellifera (honey bee): 552091Help
Entry
552091            CDS       T01057                                 

Gene name
GB16886
Definition
group XV phospholipase A2-like
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
ame  Apis mellifera (honey bee)
Pathway
Glycerophospholipid metabolism
Lysosome
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ame00564]
Cellular Processes; Transport and catabolism; Lysosome [PATH:ame04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG1
AA seq 377 aa AA seqDB search
MHLYFIIYTIISLRCILSVNSWHLRNKQISPIIFVPGDGGSQIEAKLNKTKVVHYLCEKV
STEYFNIWLNLELLVPVIIDCWIDNMKLIYDNVTRTTRNQDGVDIRIPGWGDPFVVEYLD
PSKASPGVYFNDIGNMLVNELGYVRNHSIRGAPYDFRKAPNENEIFFNKLKNLIEETYNI
NKQVPVTLLAHTVWGGSVKALKVFAIGDDLGAYLLRQSILKDEQITNPSLGWLLPSRLFW
KDTEILVQSEQKNYTLLTLQDYLIDINVPNGWEFRKDNEKYQLNFTAPEVEVHCLYGSGI
DTVQRLYYKSGTSIEGIPQLIPGDGDGTVNLRSLEGCKYWQGKQKQKVYSQVFPNVNHMD
ILKNNNVLNYIRTLLKV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcatctgtatttcattatctacacaattatttctttacgttgtattctatcagtaaat
tcgtggcatttacgaaataaacaaatatctcccattatatttgttccaggcgatggcggt
agtcaaattgaagcaaaactcaacaaaacaaaagtggtacattatttatgtgaaaaagta
tctaccgaatattttaatatctggttaaatttagaattacttgttccagttattatagat
tgctggattgataatatgaaattaatttatgataatgttacaagaacaacaagaaatcaa
gatggtgttgatatacgtataccaggctggggtgatccatttgttgttgaatatttagat
ccaagtaaagcttctcctggagtatattttaatgatattggtaatatgttagttaatgag
cttggatatgttagaaatcattctatacgaggtgcaccatatgattttagaaaagcacct
aatgaaaatgaaatattttttaataaattaaaaaatttaattgaagaaacatataatata
aataaacaagtacctgtgacattattagcacacactgtttggggtggaagtgttaaagca
cttaaagtttttgcaattggagatgatttaggtgcatatcttttacgccaaagtattctt
aaagatgaacaaataactaatcccagtttaggctggttattaccatcacgattattttgg
aaagatacagaaatattagtacaatcagaacaaaaaaactatacattattaacattacaa
gattatttaatagatataaatgttccaaatggttgggaatttagaaaagataatgaaaaa
tatcagttaaattttactgcaccagaagttgaagtgcattgtctatatggaagtggtata
gatacagtacaaagattatattataaatctggtacatcaatagaaggaattcctcaatta
attcctggtgatggtgatggtactgtaaatttaagaagtttagaaggttgtaaatattgg
caaggtaaacaaaaacaaaaagtttattctcaagtctttcctaatgtaaatcatatggac
attcttaaaaataataatgtcttgaattatattagaactcttttaaaagtatga

DBGET integrated database retrieval system