KEGG   Apis mellifera (honey bee): 552169Help
Entry
552169            CDS       T01057                                 

Gene name
GB12667
Definition
DNA repair and recombination protein RAD54B-like
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
ame  Apis mellifera (honey bee)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ame00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    552169 (GB12667)
Enzymes [BR:ame01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     552169 (GB12667)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG10
AA seq 833 aa AA seqDB search
MYRNNLNKNLENTSKHQQITCTNFKKNLENINTLSENSQQTFIRDTTKILDLFKNPITNY
KKNVQKENVSIKKEEDNTVTIKKDISIITDMNKVIFNVLIGKKTMRKHKKWDDDGTLEVI
GKHAILKDIKGNIIHKAIVNPEVLTEGFRMYIDNKEIEIIDRVLPKYMLNRSIPEKILEP
PAKKLKTSISKPYLPLECLYKEIKLKCSPFIMPSVNISRDCKKNMLQNEQEVSVDTCLVN
VLRPHQRHGIVFLYECIMGLKVPNYFGAILADEMGLGKTLQCITIIWTLLKKGPYGYPIL
KYVLIVTPSSLCNNWNKEFKHWLGFHRISPYVVNAKNKPNNFKKQIRNSIMIISYEMLIK
YQQEIEQIAFDLIICDEGHRLKNNDIKTTKVLSNLNCKRRILLTGTPVQNDLQEFFALID
FVNPVILGSSSEFKNYYEKPIVASQCPNASCHVISLGTERANELHEKTKCFILRRTQEII
NKYLPSKHELVIFCRLSDEQEDLYSRITNLWFSKSVLPNNNISHLTLITALKKICNHPEL
FYNEKNDLYLNKVSIKNITRKGYYGKISIVQTLIKNLKKTNEKLVLISYYTQTLDLLERV
CNMECLQFLRLDGNTTSSTRSKIIEQFNSTNDNNKIFLLSAKAGGVGLNLPGASRLILFD
SDWNPASDSQAMARIWRDGQKNDVYILRLLTTGTIEEKIFQRQINKANLSETVIDLNYFS
SIKLSTSDLKDLFTLTTNTNSLTHDLMKCSCNGYKTSEEISKESHQENNREYQFLIKDKI
PNVKNLTINQLLKWEHYQQPIPNKIIQEIMLSEVSDNITFILKNSILNKTKLN
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgtaataatttaaacaaaaatttagaaaatacttcgaaacatcaacaaataaca
tgtactaatttcaaaaagaatttagaaaatattaatactttatcggaaaattcacaacaa
acttttattagagatacaacaaaaattcttgatttatttaaaaatcccattacaaattat
aaaaaaaacgtacaaaaagaaaatgtttcaatcaagaaagaagaagacaatacagttacg
attaaaaaagatatatccattattactgatatgaacaaagttatttttaatgtattaata
ggtaaaaagactatgagaaaacataaaaaatgggatgatgatggaacattggaagtaata
ggaaaacatgcaatcttaaaggatataaaaggcaatattatccataaagccatagttaat
ccagaagttttgacagaaggttttagaatgtatatagataataaagaaattgagataatt
gatagagtactgcccaaatatatgctcaatagatccattccggaaaaaattttagaacca
cctgcaaagaagttaaaaacatcaatttctaaaccatatcttcctttagaatgtttatat
aaagaaataaaattgaaatgcagcccatttataatgccatctgtaaatatttcacgggat
tgtaaaaaaaatatgttacaaaatgaacaagaagtatctgtagatacttgtttagtaaat
gtacttagaccacatcaacgtcatggtattgtatttctatatgaatgtattatgggctta
aaggtacctaattattttggagcaattttggctgatgaaatgggacttggaaaaacatta
caatgcattacaattatttggacattattaaaaaagggaccatatggatatccaatattg
aaatatgtattaatagtaactcctagtagtttgtgtaacaattggaataaagaatttaaa
cattggttgggttttcatagaatatctccgtatgttgtaaatgctaaaaacaaaccaaat
aatttcaagaaacaaataaggaattcaattatgattattagttatgaaatgcttattaaa
tatcaacaagaaattgaacaaatagcttttgatttaattatatgtgatgaaggtcataga
ttaaaaaataatgatataaagacaacaaaggttttgagcaatttgaattgtaaaagaaga
atacttttaactggaactcctgtgcaaaatgatttgcaagaattttttgcattaattgat
tttgtaaatcctgttatattgggcagtagttctgaatttaaaaattattatgaaaaacct
atagttgcatcacaatgtcctaatgcatcatgtcatgttatatctcttggaactgaaaga
gctaatgaattacatgaaaaaactaaatgttttatattaagacgtacccaagaaataatt
aataagtatttaccttctaagcatgaattagttatattttgtcgtttatcagatgaacaa
gaagatttgtattcaagaatcacaaacttatggtttagtaaaagtgtattaccaaataac
aatatatctcatttaactttaataacagctcttaaaaagatttgtaatcatccagaatta
ttttataatgaaaaaaatgatctatatttgaataaagtttctataaaaaatattacaaga
aagggatattatggaaagatttcaattgtacaaacattaataaaaaatttaaaaaaaact
aatgaaaaattagtattaatttcatattatacgcaaacacttgatttactagaaagagtt
tgtaatatggaatgtttacaatttcttagattagatggtaatacaacaagtagtacaaga
tctaaaattatagaacaattcaattcaacaaatgataataataaaatatttttattaagt
gcaaaggctggtggagttggattaaatttacctggagcatctcgacttatattatttgat
tcagattggaatccagcatctgattcacaagctatggcaagaatttggagagatggtcaa
aaaaatgatgtttatatattacgattactgacaacaggtactattgaagaaaagattttt
caaagacaaattaacaaagcaaatttaagtgaaactgtaatagatttaaattatttctct
tctattaaattatctactagtgatttaaaggatttgtttacattaacaacaaatacaaat
agtttaacacatgatttaatgaagtgttcttgtaatggatataaaacatcggaagaaata
tcaaaagaatcacatcaagaaaataatagagaatatcaatttcttataaaagataaaata
ccaaatgtcaaaaatttaacaataaatcagcttttgaaatgggaacattatcaacaacca
atcccaaacaaaataattcaagaaattatgctgtcagaagtgtctgataatataactttt
atattaaaaaattctatattaaataagacaaaattaaattaa

DBGET integrated database retrieval system