KEGG   Apis mellifera (honey bee): 552286Help
Entry
552286            CDS       T01057                                 

Gene name
GB17684
Definition
acetyl-CoA carboxylase-like
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
ame  Apis mellifera (honey bee)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    552286 (GB17684)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    552286 (GB17684)
   00640 Propanoate metabolism
    552286 (GB17684)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    552286 (GB17684)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    552286 (GB17684)
Enzymes [BR:ame01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     552286 (GB17684)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     552286 (GB17684)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG12
AA seq 2351 aa AA seqDB search
MNLTSMRNVLLHRERFVTGNDNRREEGEEERRSTENENKSFSIGDAMAENPVSFVVGGPD
NDPAEESEVEDTFPSETNDFETQNAMAGLIERRKRLRPSMSQGTVMIQTQSRLHEKDFTI
ATPEEFVHRFGGTRVINKVLIANNGIAAVKCMRSIRRWSYEMFKNERAVRFVVMVTPEDL
KANAEYIKMADQYVPVPGGTNNNNYANVELIVDIAIRTQVQAVWAGWGHASENPKLPELL
HKNNMCFIGPSERAMWALGDKIASSIVAQTADVPTLPWSGSELTAQYSGKKIKISSELFK
KGCVSTVEECLAAANKIGFPIMVKASEGGGGKGIRKVENAEELPTLFRQVQTEIPGSPIF
IMKLAKCARHLEVQLLADNYGNAISLFGRDCSIQRRHQKIIEEAPAVIAKPEVFEEMEKA
AVRLAKMVGYVSAGTVEYLYDTSGRYYFLELNPRLQVEHPCTEMVSDVNLPAAQLQIAMG
LPLHHIKDIRLLYGESPWGDSVIDFDQPRHKPQPWGHVIAARITSENPDEGFKPSSGTVQ
ELNFRSSKNVWGYFSVGASGGLHEFADSQFGHCFSWGEDRNQARENLVIALKELSIRGDF
RTTVEYLITLLETESFQQNNIDTAWLDLLIAERVRSDKPDVLLAVTCGALHIADRTITAA
FTGFQTALEKGQIQASNDLDNIIDVELINDGYKYKVQTAKSGPNSYFLVMNGSYKEVEVH
RLSDGGLLLSLDGASFTTYMREEVDRYRIIIGNQTCIFEKDNDPSLLRSPSAGKLISYLV
EDGGHVNAGQAYAEIEVMKMVMTITASEAGRVFYVKRPGAILEAGTLIAQLELDDPSLVT
KAQDYTGQFPETAAPAIPEKLNHLHAKYRIALENTLAGYCLPDPYHLPRVRELLEKFMNS
LRDPSLPLLELQEVIATISGRIPISVEKKIRKLMSLYERNITSVLAQFPSQQIAAVIDGH
AATLSKRSERDVFFLTTQAIVQLVQRYRNGIRGRMKTAVHELLRQYYTVESQFQQGHYDK
CVSALIEQYKDDVATVTAMIFSHNQVTKKNVLVTMLIDHLWANEPGLTDELSSTLTELTS
LNRTEHSRVALRARQILIAAHQPAYELRHNQMESIFLSAVDMYGHDFHPENLQKLILSET
SIFDILHDFFYHSNRAVCNAALEVYVRRAYISYELTCLQHLELSGEVPLVHFQFLLPNNH
PNIQNQSSVNHRIGAMAAFQDMDQFVRYSDEVFDLLEDLSSVTTVSAKVLEAVDAAGSES
RHSTSINVSLSTAETAGPVEVGERPTEPVHILSIAVQEKENHDDAIMAKIFGDWCATNKE
ELILRGIKRITFAALKKRQFPKFFTFRQRDGFVEDKIYRHLEPGCAFQLELNRMRTYDLE
ALPTSNQKMHLYLGQAKVAKGQQVTDYRFFIRSIIRHSDLITKEASFDYLHNEGERVLLE
AMDELEVAFSHPLAKRTECNHIFLNFVPTVIMDPARIEESVTSMVLRYGPRLWKLRVRHA
EIKMTIRPAPGKPTSIIRLCIANDSGYSIDLHLYTEITDPKTGIIRFESYPSAKANGTWR
PGPMHGLPISTPYLTKDYLQAKRFQAQSAGTTYVYDLPDMFRQQTEKLWHKYIEEREQSD
ITIPNTVMDCVELVLEGENLVEQKRLPGENNIGMVAWRLRLYTPEYPITGRDIILIANDL
THLIGSFGPKEDLVFFKASERARQLGIPRIYFSANSGARIGLAEEVKGLFRIAWEDDDEP
EKGFKYIYLTPDDYARLAPFNSVKTSLIEDKGESRYKITDIIGKEDGLGVENLKYAGMIA
GETSKAYDEIVTISIVSCRAIGIGSYLLRLGQRVIQIENSHIILTGYKALNVVLGREVYA
SNNQLGGIQIMHNNGISHATDVRDIEGIATALRWLSYCPKYKGAPLPILSSLLPDPIDRE
ITYVPTKTAYDPRLMLEGRIQNGTNYWESGFFDRGSWQEIMRPWAQTVVTGRARLGGIPC
GVIAVETRTVELHLPADPANLDSEAKTISQAGQVWFPDSAYKTAQAIQDFGKEELPLFIF
ANWRGFSGGMKDMYEQIIKFGAYIVDGLRKYTKPIFIYIPPNGELRGGAWAVVDPTINPR
YMEMFADNTSRAGVLEPSGIVEIKFRNKDLIKTMHRIDTVIQKLKENLSNVNSPEERKEI
ESQIRKREQTLEPMYHQVAIHFADLHDTPERMYEKNVIHDIIPWRKARRLLYWRLRRRLL
EDEIKEEVLSTQRNLDVDFRQVGAMLRRWFIEDKGATESYLWDQDEVATNWLENQRQDEN
SVVSRNITCVKQDAIVSRIKEALEACPEVRLNAILEIAHRLHPAERTELQRTLSQIEMTA
QEHHNDSSGSS
NT seq 7056 nt NT seq  +upstreamnt  +downstreamnt
atgaacttaacctcaatgaggaacgtgctactccaccgcgaaagattcgtcaccggtaac
gataacagaagagaggagggagaggaggagaggaggtcgacagagaacgagaacaaatcc
ttcagcatcggtgacgctatggcggaaaatccggtgagcttcgtggttggggggccagac
aacgatcccgccgaagagtcggaagtggaggatacctttccatccgaaacaaacgatttc
gagacgcagaatgccatggcaggcttgatcgagcgccgcaagcggctcaggcccagtatg
tcgcagggtacggtgatgatccagacgcaaagccggctacatgaaaaggactttaccatt
gccacacctgaagaatttgttcatcgtttcggcggtacaagagtcattaacaaagttttg
attgccaacaatggaatagcagcagtaaaatgtatgcgttcgatccgtcgatggtcctac
gaaatgttcaagaacgaacgcgctgtgcgctttgttgtaatggtaactccggaagatttg
aaagcgaacgcggaatacatcaaaatggcagaccaatacgtacctgtaccaggtggaacc
aacaacaataattatgcaaacgtcgagctgatcgtagacatcgctatacgtacgcaagtc
caggctgtatgggcaggatggggtcatgcatcagaaaatccaaagttgccagaattgctt
cataaaaataacatgtgtttcattggaccatccgaaagagcaatgtgggctcttggagat
aaaattgcatctagtattgtagcacaaactgcagatgtacctacacttccctggtcaggt
tcagaattgacggcgcaatatagtgggaagaagataaaaatatcttcagaacttttcaaa
aaaggatgcgtttcaacggtagaggaatgcttggcagcagccaataaaataggctttcct
ataatggtaaaagctagcgaaggaggtggtggcaaaggtataagaaaagttgaaaacgct
gaagaattacctacgttatttaggcaggtacaaactgagatacctggatctccgatattc
attatgaagttagcaaaatgtgcacgtcatttagaggttcaattactagctgataattat
ggaaatgcgatatcgttgttcggtcgtgattgttctattcagagaagacatcaaaaaatt
atcgaagaggcaccagccgtaattgctaaacctgaagtctttgaagaaatggaaaaagct
gctgtaagattagccaaaatggttggatatgtcagtgcgggtactgtcgaatatctttac
gacacttctggacggtattactttttggaattgaatccacgtcttcaagtagaacatcca
tgtactgaaatggtatctgatgttaatttacctgcggctcaacttcagattgctatggga
ttgcccttacatcatattaaagacattcgtcttctttatggtgaaagtccatggggagat
agcgtcattgatttcgatcaaccacgacataaacctcaaccatggggtcatgtgatagca
gcaagaattactagtgaaaatcctgatgaaggttttaaaccaagttcgggtaccgttcaa
gaattgaattttcggtcttcaaaaaatgtttggggttatttctcggtaggagcttctgga
ggtcttcacgaattcgcagattctcagtttggtcattgtttttcttggggagaggatcgt
aaccaggcccgagaaaatttagtcatagctttaaaagaattgagtattaggggtgatttc
agaaccactgtcgaatatttgatcacattattagaaactgaatcttttcaacaaaacaat
atagacactgcttggcttgatttattgattgccgaacgcgttagaagtgataaaccggat
gtattattagccgtaacatgtggcgcgcttcatatcgctgataggacaatcacggccgct
ttcactggatttcaaacagcattggaaaaaggacaaatacaagctagtaatgatttagat
aatattatcgatgttgaacttattaacgatggatataaatataaagtacagactgctaag
tcaggtcctaatagttattttcttgttatgaacggttcctacaaagaagtagaagtacat
cgactgtcagatggaggattgctgctttctttagatggtgcaagttttactacttatatg
agggaagaagttgatcgttatagaattatcattggaaatcaaacttgcatctttgaaaag
gataacgatccttctttattaagatcaccatcagccggaaaattgatcagttatttggtg
gaagatggtggacatgtgaatgctggacaagcctatgcagaaattgaagttatgaaaatg
gtaatgacaataacagcgagcgaagctggtcgtgtcttctatgttaaaagaccgggtgct
attcttgaggctggtactttgattgctcaattagagttggacgatccgtctttggtaaca
aaagcccaagattatactggtcaattcccagaaactgcagcaccagcaataccggaaaaa
ttaaatcatttacatgctaaatatagaatcgctttagaaaacactttagcaggatattgt
ttgccagatccatatcatttacctcgagtacgagaacttcttgagaaatttatgaattca
cttcgtgatcctagcttacctctacttgaattacaagaagtaatcgcaacaatatcagga
agaattccgatttctgtcgagaagaaaatcagaaaattaatgtcgttatatgaaagaaat
ataacttctgttttagctcaatttcctagtcaacaaattgctgctgtaattgatggacat
gcagcaactctttcaaagcgatctgaacgtgacgtattttttttaactactcaagctata
gtacaattagtacaaagatatagaaatggaatacgtggaagaatgaaaactgctgttcac
gaacttcttcgacaatattatacagttgaaagccagttccaacaagggcattatgataaa
tgtgtttcagctttaatagaacagtacaaagatgatgtagcaacagtaacagctatgatc
tttagtcacaatcaagtcacaaagaagaatgttttagtaacaatgctcattgatcatctt
tgggcaaatgaacctggcctcacggatgaattgtcgagtacattgacagaattaacgagt
ttgaatcgtacagagcatagtcgtgtggcattacgtgcaagacaaattctaatcgctgct
caccaacctgcatatgaattaagacataatcaaatggaatctatatttttgtcagcagta
gatatgtacggccatgatttccatccagaaaatttacaaaaattgattctttctgaaaca
tctattttcgatattttacacgatttcttttatcattccaatcgtgcagtttgtaatgct
gctttagaagtttatgttcgcagagcttatatcagttatgagttaacgtgtttacaacat
ttagaactatcaggtgaagtaccacttgtacatttccaattcttattacctaataatcat
cccaatatacagaatcaatcttcagttaatcatagaattggagctatggcagctttccaa
gacatggatcaattcgttcgatattctgacgaagttttcgatctcttagaagatttatct
tcggttaccacagtttcagccaaagttttagaagcagtagatgcagctggaagcgaatcg
agacatagcacatctataaatgtatctctaagtactgcagaaactgctggtccagtggaa
gttggtgaacgaccaacagaaccggtacatattttaagtattgccgtccaagaaaaggaa
aatcacgatgatgctataatggcaaaaatttttggagattggtgtgctacaaataaagaa
gaattaatcttgcgaggtataaagagaatcacgttcgctgctttaaagaaaagacaattt
cctaaattctttacatttcgtcaaagagatggttttgttgaagataaaatttatcgacat
cttgaacctggttgcgcttttcaattagaattaaatagaatgagaacttatgatcttgaa
gctttaccaacttcgaatcaaaaaatgcatctgtatcttggtcaagcaaaagttgctaaa
ggacaacaagttacagattatcgtttctttattcgttctattataagacattctgatctt
atcacaaaagaagctagttttgattatctccataatgaaggtgaacgtgttttattagaa
gctatggatgaattagaagttgcattttcacatcctcttgcaaaacgtacggaatgtaat
catatttttctgaactttgtacctacagttattatggatccagcaagaatagaagaaagt
gtaacaagtatggtattgagatatggtccaagattatggaaattacgagtccgtcatgct
gagattaaaatgacgattcgtccagcaccaggaaaaccaacatctattatacgtttatgt
attgctaatgatagcggatatagtatagatttacacctttacacagaaataactgatcca
aagactggtatcattcgttttgaatcttatccttctgcaaaagcaaatggtacttggaga
cctggacctatgcatggtttaccgatttctacgccatatctaaccaaagattatcttcaa
gcaaaacgatttcaagcacaaagtgctggtacaacatatgtatatgatttaccagacatg
tttagacaacaaaccgagaaactatggcataaatacatagaagaaagagaacaatctgat
ataacgattccgaatactgtaatggattgcgtggaattagtattagagggtgaaaattta
gtagaacagaaacgtcttcctggtgagaataatatcggtatggtcgcttggagattaaga
ctttatacaccagaatatcctataactggaagagacattatattaattgcgaacgactta
acacatttaattggttcttttggcccaaaagaagatttagtatttttcaaagcatctgaa
agagctagacaacttggaattcctcgaatatatttttccgcaaattctggagctcgtatt
ggtttagcagaagaagtaaaaggattattcagaatcgcttgggaggatgatgatgaacca
gaaaaaggattcaaatatatatatctaactccagatgattacgcacgcttagcaccattt
aattcagtaaaaacttcgttgattgaagataagggagaatctcgttacaaaattactgat
attatcggtaaagaggatggtcttggtgtagaaaatttgaaatatgctggtatgattgct
ggagaaacgtcaaaagcttatgatgaaatagttacaatttctattgtttcttgtcgtgct
attggtatcggttcttatttattacgtcttgggcaaagagtgattcaaatagaaaattct
catatcattttaaccggatataaagcattaaatgttgtattaggtcgtgaagtatatgct
agtaacaatcaattaggtggtatacaaatcatgcataataatggaatatcacatgcaact
gatgtaagagatatagagggtattgccactgctttaagatggttaagttattgtccgaaa
tataaaggagcgcctcttcctatattatcatcacttcttcctgatcctattgatagagag
attacttatgttcctacaaagacagcttatgatccaagattaatgcttgaaggtagaata
caaaatggtacaaattattgggagagtggattttttgatcgtggctcttggcaggaaata
atgagaccttgggctcaaactgtggtaactggacgagctagattaggaggaattccttgt
ggtgtcattgcagtagaaacaagaactgttgaattgcatttacccgctgatcctgctaat
ctcgattcagaagctaaaacaatctctcaagcaggacaagtatggtttcctgatagtgca
tataaaactgcacaagctattcaagattttggaaaagaagaacttccactttttatcttt
gctaattggagaggattttctggtggaatgaaagatatgtatgaacaaattatcaaattt
ggtgcttacattgtggatggattaagaaaatatactaaaccaatatttatatatattcca
ccaaatggtgaattaagaggtggtgcttgggcagttgttgatccaacaataaatcctcgt
tacatggaaatgtttgctgacaatacaagtcgagctggagttttagaacctagtggaata
gtagaaataaaatttagaaataaagatttaattaaaactatgcataggattgatacagta
atacaaaaacttaaagaaaacttatccaatgtaaattcacctgaagaacgaaaagaaatc
gaaagtcaaatacgtaagagagaacaaactttagaacctatgtatcatcaagttgcaatt
catttcgcggatcttcacgacacaccagaaagaatgtacgaaaaaaatgtcattcatgat
attattccatggcgaaaagcacgaagattactttactggcgacttagaagaagactttta
gaggatgaaataaaagaggaagttctttcaacgcaacgaaatttagatgttgattttaga
caagtaggtgcgatgttgcgtagatggttcatagaggataaaggtgccacggaatcatat
ttatgggatcaagatgaagtagcgacgaattggttggaaaatcaacgacaagatgaaaat
agtgttgtttcacgtaatatcacttgtgttaaacaagatgcaatcgtttctcgaatcaaa
gaagctttagaagcttgtccagaagtgagattaaatgcaattttagaaattgcgcacaga
ctacatccagcagaacgcacggaattacaaagaactttgtcacaaatagaaatgactgca
caggagcatcataatgattcaagtggttcatcctaa

DBGET integrated database retrieval system