KEGG   Apis mellifera (honey bee): 552286Help
Entry
552286            CDS       T01057                                 

Definition
(RefSeq) acetyl-CoA carboxylase
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14]
Organism
ame  Apis mellifera (honey bee)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    552286
   00640 Propanoate metabolism
    552286
  Lipid metabolism
   00061 Fatty acid biosynthesis
    552286
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    552286
Enzymes [BR:ame01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     552286
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     552286
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
BEEBASE: 
Position
LG12
AA seq 2351 aa AA seqDB search
MNLTSMRNVLLHRERFVTGNDNRREEGEEERRSTENENKSFSIGDAMAENPVSFVVGGPD
NDPAEESEVEDTFPSETNDFETQNAMAGLIERRKRLRPSMSQGTVMIQTQSRLHEKDFTI
ATPEEFVHRFGGTRVINKVLIANNGIAAVKCMRSIRRWSYEMFKNERAVRFVVMVTPEDL
KANAEYIKMADQYVPVPGGTNNNNYANVELIVDIAIRTQVQAVWAGWGHASENPKLPELL
HKNNMCFIGPSERAMWALGDKIASSIVAQTADVPTLPWSGSELTAQYSGKKIKISSELFK
KGCVSTVEECLAAANKIGFPIMVKASEGGGGKGIRKVENAEELPTLFRQVQTEIPGSPIF
IMKLAKCARHLEVQLLADNYGNAISLFGRDCSIQRRHQKIIEEAPAVIAKPEVFEEMEKA
AVRLAKMVGYVSAGTVEYLYDTSGRYYFLELNPRLQVEHPCTEMVSDVNLPAAQLQIAMG
LPLHHIKDIRLLYGESPWGDSVIDFDQPRHKPQPWGHVIAARITSENPDEGFKPSSGTVQ
ELNFRSSKNVWGYFSVGASGGLHEFADSQFGHCFSWGEDRNQARENLVIALKELSIRGDF
RTTVEYLITLLETESFQQNNIDTAWLDLLIAERVRSDKPDVLLAVTCGALHIADRTITAA
FTGFQTALEKGQIQASNDLDNIIDVELINDGYKYKVQTAKSGPNSYFLVMNGSYKEVEVH
RLSDGGLLLSLDGASFTTYMREEVDRYRIIIGNQTCIFEKDNDPSLLRSPSAGKLISYLV
EDGGHVNAGQAYAEIEVMKMVMTITASEAGRVFYVKRPGAILEAGTLIAQLELDDPSLVT
KAQDYTGQFPETAAPAIPEKLNHLHAKYRIALENTLAGYCLPDPYHLPRVRELLEKFMNS
LRDPSLPLLELQEVIATISGRIPISVEKKIRKLMSLYERNITSVLAQFPSQQIAAVIDGH
AATLSKRSERDVFFLTTQAIVQLVQRYRNGIRGRMKTAVHELLRQYYTVESQFQQGHYDK
CVSALIEQYKDDVATVTAMIFSHNQVTKKNVLVTMLIDHLWANEPGLTDELSSTLTELTS
LNRTEHSRVALRARQILIAAHQPAYELRHNQMESIFLSAVDMYGHDFHPENLQKLILSET
SIFDILHDFFYHSNRAVCNAALEVYVRRAYISYELTCLQHLELSGEVPLVHFQFLLPNNH
PNIQNQSSVNHRIGAMAAFQDMDQFVRYSDEVFDLLEDLSSVTTVSAKVLEAVDAAGSES
RHSTSINVSLSTAETAGPVEVGERPTEPVHILSIAVQEKENHDDAIMAKIFGDWCATNKE
ELILRGIKRITFAALKKRQFPKFFTFRQRDGFVEDKIYRHLEPGCAFQLELNRMRTYDLE
ALPTSNQKMHLYLGQAKVAKGQQVTDYRFFIRSIIRHSDLITKEASFDYLHNEGERVLLE
AMDELEVAFSHPLAKRTECNHIFLNFVPTVIMDPARIEESVTSMVLRYGPRLWKLRVRHA
EIKMTIRPAPGKPTSIIRLCIANDSGYSIDLHLYTEITDPKTGIIRFESYPSAKANGTWR
PGPMHGLPISTPYLTKDYLQAKRFQAQSAGTTYVYDLPDMFRQQTEKLWHKYIEEREQSD
ITIPNTVMDCVELVLEGENLVEQKRLPGENNIGMVAWRLRLYTPEYPITGRDIILIANDL
THLIGSFGPKEDLVFFKASERARQLGIPRIYFSANSGARIGLAEEVKGLFRIAWEDDDEP
EKGFKYIYLTPDDYARLAPFNSVKTSLIEDKGESRYKITDIIGKEDGLGVENLKYAGMIA
GETSKAYDEIVTISIVSCRAIGIGSYLLRLGQRVIQIENSHIILTGYKALNVVLGREVYA
SNNQLGGIQIMHNNGISHATDVRDIEGIATALRWLSYCPKYKGAPLPILSSLLPDPIDRE
ITYVPTKTAYDPRLMLEGRIQNGTNYWESGFFDRGSWQEIMRPWAQTVVTGRARLGGIPC
GVIAVETRTVELHLPADPANLDSEAKTISQAGQVWFPDSAYKTAQAIQDFGKEELPLFIF
ANWRGFSGGMKDMYEQIIKFGAYIVDGLRKYTKPIFIYIPPNGELRGGAWAVVDPTINPR
YMEMFADNTSRAGVLEPSGIVEIKFRNKDLIKTMHRIDTVIQKLKENLSNVNSPEERKEI
ESQIRKREQTLEPMYHQVAIHFADLHDTPERMYEKNVIHDIIPWRKARRLLYWRLRRRLL
EDEIKEEVLSTQRNLDVDFRQVGAMLRRWFIEDKGATESYLWDQDEVATNWLENQRQDEN
SVVSRNITCVKQDAIVSRIKEALEACPEVRLNAILEIAHRLHPAERTELQRTLSQIEMTA
QEHHNDSSGSS
NT seq 7056 nt NT seq  +upstreamnt  +downstreamnt
atgaacttaacctcaatgaggaacgtgctactccaccgcgaaagattcgtcaccggtaac
gataacagaagagaggagggagaggaggagaggaggtcgacagagaacgagaacaaatcc
ttcagcatcggtgacgctatggcggaaaatccggtgagcttcgtggttggggggccagac
aacgatcccgccgaagagtcggaagtggaggatacctttccatccgaaacaaacgatttc
gagacgcagaatgccatggcaggcttgatcgagcgccgcaagcggctcaggcccagtatg
tcgcagggtacggtgatgatccagacgcaaagccggctacatgaaaaggactttaccatt
gccacacctgaagaatttgttcatcgtttcggcggtacaagagtcattaacaaagttttg
attgccaacaatggaatagcagcagtaaaatgtatgcgttcgatccgtcgatggtcctac
gaaatgttcaagaacgaacgcgctgtgcgctttgttgtaatggtaactccggaagatttg
aaagcgaacgcggaatacatcaaaatggcagaccaatacgtacctgtaccaggtggaacc
aacaacaataattatgcaaacgtcgagctgatcgtagacatcgctatacgtacgcaagtc
caggctgtatgggcaggatggggtcatgcatcagaaaatccaaagttgccagaattgctt
cataaaaataacatgtgtttcattggaccatccgaaagagcaatgtgggctcttggagat
aaaattgcatctagtattgtagcacaaactgcagatgtacctacacttccctggtcaggt
tcagaattgacggcgcaatatagtgggaagaagataaaaatatcttcagaacttttcaaa
aaaggatgcgtttcaacggtagaggaatgcttggcagcagccaataaaataggctttcct
ataatggtaaaagctagcgaaggaggtggtggcaaaggtataagaaaagttgaaaacgct
gaagaattacctacgttatttaggcaggtacaaactgagatacctggatctccgatattc
attatgaagttagcaaaatgtgcacgtcatttagaggttcaattactagctgataattat
ggaaatgcgatatcgttgttcggtcgtgattgttctattcagagaagacatcaaaaaatt
atcgaagaggcaccagccgtaattgctaaacctgaagtctttgaagaaatggaaaaagct
gctgtaagattagccaaaatggttggatatgtcagtgcgggtactgtcgaatatctttac
gacacttctggacggtattactttttggaattgaatccacgtcttcaagtagaacatcca
tgtactgaaatggtatctgatgttaatttacctgcggctcaacttcagattgctatggga
ttgcccttacatcatattaaagacattcgtcttctttatggtgaaagtccatggggagat
agcgtcattgatttcgatcaaccacgacataaacctcaaccatggggtcatgtgatagca
gcaagaattactagtgaaaatcctgatgaaggttttaaaccaagttcgggtaccgttcaa
gaattgaattttcggtcttcaaaaaatgtttggggttatttctcggtaggagcttctgga
ggtcttcacgaattcgcagattctcagtttggtcattgtttttcttggggagaggatcgt
aaccaggcccgagaaaatttagtcatagctttaaaagaattgagtattaggggtgatttc
agaaccactgtcgaatatttgatcacattattagaaactgaatcttttcaacaaaacaat
atagacactgcttggcttgatttattgattgccgaacgcgttagaagtgataaaccggat
gtattattagccgtaacatgtggcgcgcttcatatcgctgataggacaatcacggccgct
ttcactggatttcaaacagcattggaaaaaggacaaatacaagctagtaatgatttagat
aatattatcgatgttgaacttattaacgatggatataaatataaagtacagactgctaag
tcaggtcctaatagttattttcttgttatgaacggttcctacaaagaagtagaagtacat
cgactgtcagatggaggattgctgctttctttagatggtgcaagttttactacttatatg
agggaagaagttgatcgttatagaattatcattggaaatcaaacttgcatctttgaaaag
gataacgatccttctttattaagatcaccatcagccggaaaattgatcagttatttggtg
gaagatggtggacatgtgaatgctggacaagcctatgcagaaattgaagttatgaaaatg
gtaatgacaataacagcgagcgaagctggtcgtgtcttctatgttaaaagaccgggtgct
attcttgaggctggtactttgattgctcaattagagttggacgatccgtctttggtaaca
aaagcccaagattatactggtcaattcccagaaactgcagcaccagcaataccggaaaaa
ttaaatcatttacatgctaaatatagaatcgctttagaaaacactttagcaggatattgt
ttgccagatccatatcatttacctcgagtacgagaacttcttgagaaatttatgaattca
cttcgtgatcctagcttacctctacttgaattacaagaagtaatcgcaacaatatcagga
agaattccgatttctgtcgagaagaaaatcagaaaattaatgtcgttatatgaaagaaat
ataacttctgttttagctcaatttcctagtcaacaaattgctgctgtaattgatggacat
gcagcaactctttcaaagcgatctgaacgtgacgtattttttttaactactcaagctata
gtacaattagtacaaagatatagaaatggaatacgtggaagaatgaaaactgctgttcac
gaacttcttcgacaatattatacagttgaaagccagttccaacaagggcattatgataaa
tgtgtttcagctttaatagaacagtacaaagatgatgtagcaacagtaacagctatgatc
tttagtcacaatcaagtcacaaagaagaatgttttagtaacaatgctcattgatcatctt
tgggcaaatgaacctggcctcacggatgaattgtcgagtacattgacagaattaacgagt
ttgaatcgtacagagcatagtcgtgtggcattacgtgcaagacaaattctaatcgctgct
caccaacctgcatatgaattaagacataatcaaatggaatctatatttttgtcagcagta
gatatgtacggccatgatttccatccagaaaatttacaaaaattgattctttctgaaaca
tctattttcgatattttacacgatttcttttatcattccaatcgtgcagtttgtaatgct
gctttagaagtttatgttcgcagagcttatatcagttatgagttaacgtgtttacaacat
ttagaactatcaggtgaagtaccacttgtacatttccaattcttattacctaataatcat
cccaatatacagaatcaatcttcagttaatcatagaattggagctatggcagctttccaa
gacatggatcaattcgttcgatattctgacgaagttttcgatctcttagaagatttatct
tcggttaccacagtttcagccaaagttttagaagcagtagatgcagctggaagcgaatcg
agacatagcacatctataaatgtatctctaagtactgcagaaactgctggtccagtggaa
gttggtgaacgaccaacagaaccggtacatattttaagtattgccgtccaagaaaaggaa
aatcacgatgatgctataatggcaaaaatttttggagattggtgtgctacaaataaagaa
gaattaatcttgcgaggtataaagagaatcacgttcgctgctttaaagaaaagacaattt
cctaaattctttacatttcgtcaaagagatggttttgttgaagataaaatttatcgacat
cttgaacctggttgcgcttttcaattagaattaaatagaatgagaacttatgatcttgaa
gctttaccaacttcgaatcaaaaaatgcatctgtatcttggtcaagcaaaagttgctaaa
ggacaacaagttacagattatcgtttctttattcgttctattataagacattctgatctt
atcacaaaagaagctagttttgattatctccataatgaaggtgaacgtgttttattagaa
gctatggatgaattagaagttgcattttcacatcctcttgcaaaacgtacggaatgtaat
catatttttctgaactttgtacctacagttattatggatccagcaagaatagaagaaagt
gtaacaagtatggtattgagatatggtccaagattatggaaattacgagtccgtcatgct
gagattaaaatgacgattcgtccagcaccaggaaaaccaacatctattatacgtttatgt
attgctaatgatagcggatatagtatagatttacacctttacacagaaataactgatcca
aagactggtatcattcgttttgaatcttatccttctgcaaaagcaaatggtacttggaga
cctggacctatgcatggtttaccgatttctacgccatatctaaccaaagattatcttcaa
gcaaaacgatttcaagcacaaagtgctggtacaacatatgtatatgatttaccagacatg
tttagacaacaaaccgagaaactatggcataaatacatagaagaaagagaacaatctgat
ataacgattccgaatactgtaatggattgcgtggaattagtattagagggtgaaaattta
gtagaacagaaacgtcttcctggtgagaataatatcggtatggtcgcttggagattaaga
ctttatacaccagaatatcctataactggaagagacattatattaattgcgaacgactta
acacatttaattggttcttttggcccaaaagaagatttagtatttttcaaagcatctgaa
agagctagacaacttggaattcctcgaatatatttttccgcaaattctggagctcgtatt
ggtttagcagaagaagtaaaaggattattcagaatcgcttgggaggatgatgatgaacca
gaaaaaggattcaaatatatatatctaactccagatgattacgcacgcttagcaccattt
aattcagtaaaaacttcgttgattgaagataagggagaatctcgttacaaaattactgat
attatcggtaaagaggatggtcttggtgtagaaaatttgaaatatgctggtatgattgct
ggagaaacgtcaaaagcttatgatgaaatagttacaatttctattgtttcttgtcgtgct
attggtatcggttcttatttattacgtcttgggcaaagagtgattcaaatagaaaattct
catatcattttaaccggatataaagcattaaatgttgtattaggtcgtgaagtatatgct
agtaacaatcaattaggtggtatacaaatcatgcataataatggaatatcacatgcaact
gatgtaagagatatagagggtattgccactgctttaagatggttaagttattgtccgaaa
tataaaggagcgcctcttcctatattatcatcacttcttcctgatcctattgatagagag
attacttatgttcctacaaagacagcttatgatccaagattaatgcttgaaggtagaata
caaaatggtacaaattattgggagagtggattttttgatcgtggctcttggcaggaaata
atgagaccttgggctcaaactgtggtaactggacgagctagattaggaggaattccttgt
ggtgtcattgcagtagaaacaagaactgttgaattgcatttacccgctgatcctgctaat
ctcgattcagaagctaaaacaatctctcaagcaggacaagtatggtttcctgatagtgca
tataaaactgcacaagctattcaagattttggaaaagaagaacttccactttttatcttt
gctaattggagaggattttctggtggaatgaaagatatgtatgaacaaattatcaaattt
ggtgcttacattgtggatggattaagaaaatatactaaaccaatatttatatatattcca
ccaaatggtgaattaagaggtggtgcttgggcagttgttgatccaacaataaatcctcgt
tacatggaaatgtttgctgacaatacaagtcgagctggagttttagaacctagtggaata
gtagaaataaaatttagaaataaagatttaattaaaactatgcataggattgatacagta
atacaaaaacttaaagaaaacttatccaatgtaaattcacctgaagaacgaaaagaaatc
gaaagtcaaatacgtaagagagaacaaactttagaacctatgtatcatcaagttgcaatt
catttcgcggatcttcacgacacaccagaaagaatgtacgaaaaaaatgtcattcatgat
attattccatggcgaaaagcacgaagattactttactggcgacttagaagaagactttta
gaggatgaaataaaagaggaagttctttcaacgcaacgaaatttagatgttgattttaga
caagtaggtgcgatgttgcgtagatggttcatagaggataaaggtgccacggaatcatat
ttatgggatcaagatgaagtagcgacgaattggttggaaaatcaacgacaagatgaaaat
agtgttgtttcacgtaatatcacttgtgttaaacaagatgcaatcgtttctcgaatcaaa
gaagctttagaagcttgtccagaagtgagattaaatgcaattttagaaattgcgcacaga
ctacatccagcagaacgcacggaattacaaagaactttgtcacaaatagaaatgactgca
caggagcatcataatgattcaagtggttcatcctaa

DBGET integrated database retrieval system