KEGG   Apis mellifera (honey bee): 552324Help
Entry
552324            CDS       T01057                                 

Gene name
GB14886
Definition
ubiquitin carboxyl-terminal hydrolase 5-like
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     552324 (GB14886)
Peptidases [BR:ame01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   552324 (GB14886)
Exosome [BR:ame04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   552324 (GB14886)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG5
AA seq 802 aa AA seqDB search
MEKLMKHLSKIRIPQKNDKIYKDECVYSFDTPDTCTGLYINLTTFLGLGQDYIQHYYQLT
ENPIFLHIKRRRKEIPSKHQGDGPEKKITRLAIGTADGFTPDQQKYTYHESYQIIILPDF
ITIPYPTDNLPQEVEVAIKYILEAESATKVAEVEALTGTWDGEIKAISKHAANLKQLDNG
KKIPPNGWKCEKCDLTQNLWLNLTDGSIFCGRKFYDGTGGNDHAVEHYRATGYSLAVKLG
TITKEGKADVFSYDEDDMVEDPNLVSHLAHWGINIAQMEKTDKSMIELELDLNQRFGEWV
ALQEATSKLTPLYGPGYTGLANLGNSCYLNSVMQMLFVIPDFIKRFIDGASQIFQQNYTD
PANDFNVQMAKLGIGLLSGKYSDPSDTNNEHESRQGIPPRMFKTLVGRGHPGFSSNRQQD
AQEFFLHIINIINRHSRRQMNPTDCFKFQVEERYQCSRSNKVKYTYRTEYLLPLPIPIET
AVNKDEVTAYETLKNETEAKGQKLDSNALVRPRIKLSSCLQTFIRPEIVEQFYSSALNEK
TTAQKTTRLATFPDYLLIHLKKFMMKEDWTPVKLDVAVEMPDILNLSSLRGFGLQPTEEL
LPETVGTEPPPLVYDSVILNQLTDMGFPPEACERALYFTENRGLEAATNWLMEHIADSDF
ADPFVPPGIDVKPEKSKFIANEDAVAMLMGMSFTREQATKALKATDNNLERAADWIFSHQ
NELDALESENEPEHSKEIFRDGINQYKLVGFISHMGTSTMVGHYVCHLLKNNRWVIYNDD
KVALSENPPKELGYIYLYQRID
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atggagaaattaatgaaacatttatccaaaataaggataccgcaaaaaaatgataaaata
tacaaggatgaatgtgtttattcttttgatacaccagatacttgtactggtctgtatatt
aatcttactacgttcttgggattaggtcaggattatatacaacattattatcaattaaca
gaaaatcctatatttttacatattaaaagaagaaggaaagaaattccttctaaacatcaa
ggagatggtcctgaaaagaaaattactagattagcaataggaacagctgatggatttaca
ccagatcaacaaaaatatacttatcatgaatcttatcaaattattattttaccagatttt
attacgataccatatccaacagataatttacctcaagaagttgaagttgcaattaaatat
atattggaggcagaatctgcaacaaaagtagctgaagtagaagcattgactggaacttgg
gatggagaaataaaagcaatttcaaaacatgcagcaaatcttaaacaattagataatgga
aaaaagataccaccaaatggatggaaatgtgaaaaatgtgatttaactcaaaatctttgg
cttaatttaactgatggtagtattttttgtggacgtaaattttatgatggaacaggagga
aatgatcatgcagttgaacattatagagctacaggctattccttagctgtgaaattagga
actataactaaagaaggaaaagcagatgtattctcatatgatgaagatgatatggttgaa
gatccaaatttagtatcacatttagctcattggggtattaatattgcccaaatggagaaa
actgataaatctatgatagaactagaattagatctcaatcaaagatttggagaatgggtt
gcacttcaagaagcaacaagtaaattaacacctttgtatggacctggatatacaggactt
gctaacttaggaaattcttgttatttaaatagtgtcatgcaaatgttatttgtgattcca
gattttattaaaagatttatagatggtgcatcacagatatttcaacaaaattacaccgat
ccagctaatgattttaatgttcaaatggctaaacttggaattggtttactttctggtaaa
tactctgatccatcagatacaaacaatgaacacgaatcacgacaaggtattccgcctcgg
atgtttaaaacattagttggtcgtggacatcccggattttcctcaaatcgacaacaagat
gcacaagaattttttcttcacatcataaacataataaatcgtcacagtcgtcgtcaaatg
aatccaaccgattgttttaaatttcaagttgaagaaaggtatcaatgtagtcgttctaac
aaagtaaagtatacctatcgtacggaatatttattaccactaccaatacctatagaaact
gctgtaaataaggatgaagtcacagcttatgaaacattgaaaaatgaaactgaagcaaaa
ggacaaaaattggattcgaatgctcttgtcagaccacgtataaaactatcatcttgtttg
caaacatttattcgaccagaaatagtggaacaattttatagttcagctttaaatgaaaaa
acaacagcacagaaaacaactagacttgctacttttccggactatctattaattcattta
aaaaaattcatgatgaaagaagattggacaccagttaaattagatgtagcagttgaaatg
ccagacatattaaatttaagttctcttcgaggatttggtttgcagcctacagaagaatta
ttgccggaaacagttgggactgaacctccaccacttgtttatgattctgtgattttaaat
caattgacagatatgggatttccaccagaagcttgtgaaagagctttatattttacagaa
aatcgtggcttagaagcagccacaaattggttaatggagcatattgcagattcagatttt
gcagatccttttgtacctcctggaatcgatgtcaaaccagaaaaaagtaaatttatagca
aatgaagatgctgtagctatgctaatggggatgagtttcacaagagaacaagcaacaaaa
gctcttaaagcgactgataataatttagaacgtgcagcagattggatttttagtcatcaa
aatgaattggatgctttagaaagtgaaaatgaaccagaacattccaaggaaatatttaga
gatggaatcaatcaatataaattagtaggatttatatcacatatgggtacatcgacaatg
gtaggacattatgtatgccatcttctgaaaaataatcgatgggtgatatataatgatgat
aaagttgcattatctgaaaatccaccaaaagaattaggatatatatatttatatcaacgc
attgattag

DBGET integrated database retrieval system