KEGG   Apis mellifera (honey bee): 552466Help
Entry
552466            CDS       T01057                                 

Gene name
GB14141
Definition
(RefSeq) filamin-A-like
  KO
K04437  
filamin
Organism
ame  Apis mellifera (honey bee)
Brite
Cytoskeleton proteins [BR:ame04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     552466 (GB14141)
  Intermediate filaments
   Intermediate filament-binding proteins
    552466 (GB14141)
Exosome [BR:ame04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   552466 (GB14141)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BEEBASE: 
Position
Un
AA seq 838 aa AA seqDB search
MVWEEEEVETTWQEVSTFYRYGLKSVICSQYDYAERGPICYTRIDPGNEGTPPGLDFSPL
IFQSLFYVQTKKAEVKMPSGNMDKPVIEDNHDGTVSIRYDPREEGQHELSVKFNGEHVQG
SPFKFHVDSLASGYVTAYGPGLIYGVCGEPGNFNISTKDAGAGGLSLSVEGPSKAEISCH
DNKDGTISVSYLPTAPGEYKIGVKFGDKHIRGSPYVAKITGEGRKRNQISVGSSSEVQLP
GKVTDSDIRSLNASITAPSGLEEPCFLKMMPNGNMCVSFTPREAGSHTVAVKKLGKHIQN
SPFKIDVKDREVGDAKKVKVSGSGLAEGKTQVENFFSKIQRQREAVPITEVGSQCKLTFK
MPGITSFDLAATVTSPGGVTEDAEIKEVEDGLYAVAFVPKELGVHTVSVRYKEMHIPGSP
FQFTVGPLRDGGAHRVHAGGPGLERGEQGEPCEFNIWTREAGAGTLAVSVEGPSKAQIDF
KDRKDGSCYVSYVVSEPGEYRVGIKFNDQHIPDSPHKVYVSPAMGDAHKLEVAQFPESGV
QPDKPATFLVRKNGAKGELDAKIVSPSGIEDDCFIQGIDSDTYSVRFMPRENGIHNIHVK
FNGVHMQGSPFRIKVGKVEADPAALHAYGNGLKEIKTGQKTDFIIDTCNAGSGALCVTVD
GPSKVAMDCTEVEEGYKVRYTPLVPGDYYISIKYDGYHIVGSPFKVPCTGADLAERGAQE
TSSIVVETVQKISKAKQVGPVLPLFKSDASKVTSKGMGLKKAYLGKQNVFTVNASDAGNN
ILYVGVYGPKGPCDEVSMKHTGRNNYNVNYLVRERGEYIVIVKWGDEHIPGSPYKVEV
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
atggtttgggaggaagaggaggtcgaaaccacgtggcaggaggtgtcgaccttctacaga
tacggattgaagagcgttatatgcagtcaatacgattacgctgaacgtggaccgatctgt
tacaccaggattgatccgggaaacgaagggactccgccggggctcgatttctctccgtta
atatttcagagccttttctacgtgcaaacgaaaaaagccgaagtaaaaatgccgagcggg
aacatggataaaccggtgatcgaggacaatcacgacggcacagtgtccatcagatacgat
cccagggaagaagggcagcacgagctttcggtcaaattcaatggcgaacatgttcaaggt
tcaccgttcaaattccacgtggactcgttggcgagcggatacgtgactgcgtacgggcca
ggtttaatatacggcgtatgcggcgagccggggaacttcaacatctcgacgaaagacgcc
ggagccggtgggctttcgttgtcggtggaaggacccagcaaagctgagatctcctgccac
gacaacaaggatggaacgatctcggtctcgtatctaccaaccgcccctggggagtacaaa
atcggcgtgaaattcggcgacaaacacattcggggcagcccttacgttgccaaaatcaca
ggcgagggccggaagagaaatcaaatctcggttggttcatcgagcgaggtccagttaccg
ggcaaagtgacggactccgacataagatcgttgaacgcctcgatcacggccccgagcggc
ctcgaggagccctgcttcctcaagatgatgcctaacgggaacatgtgcgtctcgttcacc
ccccgcgaggccggctctcacacggtcgctgtgaagaagctgggcaagcacatccagaac
tctccgttcaagatcgacgtgaaggacagggaggtgggggacgcgaagaaggtgaaggtg
tccgggtccggcttggcggaggggaaaacgcaagtggagaacttcttctcgaagatccaa
aggcagagggaggccgtgccgatcacggaggtgggaagccagtgcaagctcacgttcaag
atgcccggcatcacgtcgttcgacctagccgccaccgtcacctccccggggggcgtgacc
gaggatgcggagatcaaggaggtggaggacggcctgtacgcggtcgccttcgtgcccaag
gagctcggggtgcacaccgtctcggttcgatacaaggagatgcacatacccgggtcgccg
ttccaattcaccgtcggccctttgagggatggcggggcgcacagggtgcacgcgggcggg
cccgggttggaaaggggcgagcagggagagccgtgcgagttcaatatatggacgagggag
gccggggctggtactctggccgtgtccgtcgagggacccagcaaagctcagatcgacttc
aaggatcgaaaagacggcagctgttacgtcagctacgtcgtttccgagcctggcgaatac
agggtaggaataaagttcaacgatcaacatatacccgattccccacacaaggtttacgtg
tcaccggcgatgggcgacgctcataagctcgaagtggcgcaatttccggaatccggcgtg
caaccggacaagccagccactttccttgttcgcaaaaatggtgccaagggtgaactcgac
gcgaagatagtgtctccaagcggtatcgaagacgattgcttcattcaagggatcgactcg
gacacttactcagtccgatttatgccgagagaaaatgggattcacaatatccacgtaaaa
ttcaacggcgtccatatgcagggcagtccattccgcatcaaggtcgggaaagtggaagcg
gatccggccgcgttacacgcatacggtaacggtttgaaagagataaaaaccgggcaaaag
acagactttatcatcgacacctgcaacgccggaagtggtgcgctgtgcgtgaccgtggac
ggacctagcaaagtcgcgatggactgcacggaagtcgaggagggttacaaagttaggtac
acgcctttggtacctggcgattattacataagcatcaaatacgatggatatcacattgtc
ggctcaccgttcaaggttccttgcaccggtgcggatctagcggaaaggggtgctcaagaa
acaagttcgatcgtggtcgaaaccgttcaaaagatttcgaaggcgaaacaagtaggacca
gttttaccactgttcaaatcggatgccagtaaagtaacgagcaaaggaatgggtctgaag
aaggcatacttgggcaaacagaatgtcttcactgtgaacgctagcgatgctggcaataac
attctctacgtcggcgtgtacgggcctaaaggaccgtgcgacgaggtgtccatgaagcac
acggggcgcaacaattacaacgtgaactatttggtccgcgaaaggggagagtacatcgtt
attgtaaaatggggggacgagcatatccctggatcaccgtacaaggtcgaagtatag

DBGET integrated database retrieval system