KEGG   Apis mellifera (honey bee): 552466Help
Entry
552466            CDS       T01057                                 

Gene name
GB14141
Definition
filamin-B-like
Orthology
K04437  
filamin
Organism
ame  Apis mellifera (honey bee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
Un
AA seq 832 aa AA seqDB search
MVWEEEEVETTWQEVSTFYRYGLKSVICSQYDYAERGPICYTRIDPGNEGTPPGLDFSPL
IFQSLFYVQTKKAEVKMPSGNMDKPVIEDNHDGTVSIRYDPREEGQHELSVKFNGEHVQG
SPFKFHVDSLASGYVTAYGPGLIYGVCGEPGNFNISTKDAGAGGLSLSVEGPSKAEISCH
DNKDGTISVSYLPTAPGEYKIGVKFGDKHIRGSPYVAKITGEGRKRNQISVGSSSEVQLP
GKVTDSDIRSLNASITAPSGLEEPCFLKMMPNGNMCVSFTPREAGSHTVAVKKLGKHIQN
SPFKIDVKDREVGDAKKVKVSGSGLAEGKTQKIQRQREAVPITEVGSQCKLTFKMPGITS
FDLAATVTSPGGVTEDAEIKEVEDGLYAVAFVPKELGVHTVSVRYKEMHIPGSPFQFTVG
PLRDGGAHRVHAGGPGLERGEQGEPCEFNIWTREAGAGTLAVSVEGPSKAQIDFKDRKDG
SCYVSYVVSEPGEYRVGIKFNDQHIPDSPHKVYVSPAMGDAHKLEVAQFPESGVQPDKPA
TFLVRKNGAKGELDAKIVSPSGIEDDCFIQGIDSDTYSVRFMPRENGIHNIHVKFNGVHM
QGSPFRIKVGKVEADPAALHAYGNGLKEIKTGQKTDFIIDTCNAGSGALCVTVDGPSKVA
MDCTEVEEGYKVRYTPLVPGDYYISIKYDGYHIVGSPFKVPCTGADLAERGAQETSSIVV
ETVQKISKAKQVGPVLPLFKSDASKVTSKGMGLKKAYLGKQNVFTVNASDAGNNILYVGV
YGPKGPCDEVSMKHTGRNNYNVNYLVRERGEYIVIVKWGDEHIPGSPYKVEV
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atggtttgggaggaagaggaggtcgaaaccacgtggcaggaggtgtcgaccttctacaga
tacggattgaagagcgttatatgcagtcaatacgattacgctgaacgtggaccgatctgt
tacaccaggattgatccgggaaacgaagggactccgccggggctcgatttctctccgtta
atatttcagagccttttctacgtgcaaacgaaaaaagccgaagtaaaaatgccgagcggg
aacatggataaaccggtgatcgaggacaatcacgacggcacagtgtccatcagatacgat
cccagggaagaagggcagcacgagctttcggtcaaattcaatggcgaacatgttcaaggt
tcaccgttcaaattccacgtggactcgttggcgagcggatacgtgactgcgtacgggcca
ggtttaatatacggcgtatgcggcgagccggggaacttcaacatctcgacgaaagacgcc
ggagccggtgggctttcgttgtcggtggaaggacccagcaaagctgagatctcctgccac
gacaacaaggatggaacgatctcggtctcgtatctaccaaccgcccctggggagtacaaa
atcggcgtgaaattcggcgacaaacacattcggggcagcccttacgttgccaaaatcaca
ggcgagggccggaagagaaatcaaatctcggttggttcatcgagcgaggtccagttaccg
ggcaaagtgacggactccgacataagatcgttgaacgcctcgatcacggccccgagcggc
ctcgaggagccctgcttcctcaagatgatgcctaacgggaacatgtgcgtctcgttcacc
ccccgcgaggccggctctcacacggtcgctgtgaagaagctgggcaagcacatccagaac
tctccgttcaagatcgacgtgaaggacagggaggtgggggacgcgaagaaggtgaaggtg
tccgggtccggcttggcggaggggaaaacgcaaaagatccaaaggcagagggaggccgtg
ccgatcacggaggtgggaagccagtgcaagctcacgttcaagatgcccggcatcacgtcg
ttcgacctagccgccaccgtcacctccccggggggcgtgaccgaggatgcggagatcaag
gaggtggaggacggcctgtacgcggtcgccttcgtgcccaaggagctcggggtgcacacc
gtctcggttcgatacaaggagatgcacatacccgggtcgccgttccaattcaccgtcggc
cctttgagggatggcggggcgcacagggtgcacgcgggcgggcccgggttggaaaggggc
gagcagggagagccgtgcgagttcaatatatggacgagggaggccggggctggtactctg
gccgtgtccgtcgagggacccagcaaagctcagatcgacttcaaggatcgaaaagacggc
agctgttacgtcagctacgtcgtttccgagcctggcgaatacagggtaggaataaagttc
aacgatcaacatatacccgattccccacacaaggtttacgtgtcaccggcgatgggcgac
gctcataagctcgaagtggcgcaatttccggaatccggcgtgcaaccggacaagccagcc
actttccttgttcgcaaaaatggtgccaagggtgaactcgacgcgaagatagtgtctcca
agcggtatcgaagacgattgcttcattcaagggatcgactcggacacttactcagtccga
tttatgccgagagaaaatgggattcacaatatccacgtaaaattcaacggcgtccatatg
cagggcagtccattccgcatcaaggtcgggaaagtggaagcggatccggccgcgttacac
gcatacggtaacggtttgaaagagataaaaaccgggcaaaagacagactttatcatcgac
acctgcaacgccggaagtggtgcgctgtgcgtgaccgtggacggacctagcaaagtcgcg
atggactgcacggaagtcgaggagggttacaaagttaggtacacgcctttggtacctggc
gattattacataagcatcaaatacgatggatatcacattgtcggctcaccgttcaaggtt
ccttgcaccggtgcggatctagcggaaaggggtgctcaagaaacaagttcgatcgtggtc
gaaaccgttcaaaagatttcgaaggcgaaacaagtaggaccagttttaccactgttcaaa
tcggatgccagtaaagtaacgagcaaaggaatgggtctgaagaaggcatacttgggcaaa
cagaatgtcttcactgtgaacgctagcgatgctggcaataacattctctacgtcggcgtg
tacgggcctaaaggaccgtgcgacgaggtgtccatgaagcacacggggcgcaacaattac
aacgtgaactatttggtccgcgaaaggggagagtacatcgttattgtaaaatggggggac
gagcatatccctggatcaccgtacaaggtcgaagtatag

DBGET integrated database retrieval system