KEGG   Apis mellifera (honey bee): 552482Help
Entry
552482            CDS       T01057                                 

Gene name
Ppox, GB10177
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ame  Apis mellifera (honey bee)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    552482 (Ppox)
Enzymes [BR:ame01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     552482 (Ppox)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG11
AA seq 481 aa AA seqDB search
MTAILGAGISGLSAAYYALGNTRMAPLVILEASNRVGGWIRSIKQSDGTIFETGPRVMRA
NTYNVLNLIEELGLSSKIIPIKVNHPAAKNRYIYADNVLHCLPNNLKGIITKNTLLNRSL
SSILWNDFKAKKILTDDESISSFVERRFGKDVSEKMIAPILCGICGGDIHKLSAKSFMTN
LFEIEQKYGSVFMGFIQQKFSDILNNKNKIELKNTNDTDTILHNTPSILAQRAKREAWST
WGLEGGFEQLPQTLAENIMKRGVNIKIKHKCEKIIFNKDCVELIINGKVEKYSSIISSLS
AKSLANLIQEQHPKLSKELHSIPTVTMIVVNFQFSKNVLPIEAFGVLIPPKEEIPILGII
FDSCALPQNSKMTVLTVMMGGAWFEKYFGKCSSEEHLKMVAIKYVNKLLCINEDPKICNV
SILKDCIPQYVIGHAQRLTRIHDYISAHKIPLGLCGSSYHGVXVSHVILSAKEAVSSIIN
I
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaatattaggtgctggtatatcaggcttatcagctgcatattatgcacttgga
aatacaagaatggctccattagttatattagaagcttcaaatcgtgtaggaggatggata
cgttctataaaacaatctgatggaacgatttttgaaacaggtccacgagttatgagagcc
aatacatataatgtattaaatttaatagaagaattaggattatcatcaaaaatcattcct
attaaagttaatcatcctgctgctaaaaatagatatatttatgcagataatgtattacat
tgtttacctaataatttaaaaggaattataacaaaaaatacattattaaatcgttcttta
agtagtattttatggaatgacttcaaagcaaagaaaattcttacagatgatgaaagcata
tctagttttgtagaaagaagatttggcaaagatgtgtctgaaaaaatgattgccccaata
ttatgtggaatttgtggtggtgatatacataaattaagtgcaaaatcatttatgacaaat
ttatttgaaattgagcagaaatatggttctgtatttatgggttttatacaacaaaaattt
tcagacatattaaataataaaaacaaaattgaattgaaaaatacaaatgatactgataca
atattacataacacaccttcaattttagcacaaagagctaaaagagaagcatggagcaca
tggggtcttgaaggaggttttgaacaattacctcaaacactagcagaaaatataatgaaa
cgtggagtaaatataaaaataaaacataaatgtgaaaaaattatatttaataaagattgt
gtggaattaattataaatggaaaagttgaaaaatattctagtattatatcaagtttatct
gctaaaagtttagctaatttaatacaagagcaacatccaaaactatctaaagaattacat
agtatacctacagtaacaatgattgtagttaattttcaattttctaaaaatgttttacct
attgaagcttttggagttcttattccaccaaaagaagaaattccaattctgggtataata
tttgattcatgtgcccttcctcaaaactccaaaatgacagtactgacagtaatgatgggt
ggggcatggtttgaaaaatactttggtaaatgttcatctgaagaacatttaaaaatggtt
gcaattaaatatgtaaataaacttttatgcattaatgaagatcccaagatatgtaatgtt
tccattctgaaagactgtattccacaatatgtaattggtcacgcacaacggttaactcgt
atccacgattatatctccgcgcataaaatacctttggggctgtgtggttcttcataccac
ggtgtangagtctctcatgttattctgtcagcaaaagaagctgtttctagtataatcaat
atatga

DBGET integrated database retrieval system