KEGG   Apis mellifera (honey bee): 552526Help
Entry
552526            CDS       T01057                                 

Gene name
mRpS18B
Definition
(RefSeq) 28S ribosomal protein S18b, mitochondrial
  KO
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
ame  Apis mellifera (honey bee)
Brite
Ribosome [BR:ame03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    552526 (mRpS18B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG10
AA seq 189 aa AA seqDB search
MLLINKLQLAASLFKTNLTIKVISVNFIHSTFAKYDKIEDIENDTDLSIPLSKDRSKIIP
VDISIKYLKSSAYKQTYGNEPIWKYYKRNFKGHIPPIKTRKTCIRSGIIATGSPCPICRD
EYLVLDYRNVDLLKQFISKDTGEILNYDYTSLCQKAYKDLLVAIMKSREYGLFPYHVPFR
YYDYSEWKN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgttgttaataaataaattacagttagctgcctcactttttaaaactaatttaactata
aaagttatatcagtgaattttattcattctacatttgcaaaatatgacaaaatagaagat
attgaaaatgatacagatttatcaattcctctttcaaaagatagaagtaaaataattcct
gtagatattagtataaaatatcttaaaagtagtgcttataaacaaacttacggaaacgaa
cctatttggaaatattataaacgaaattttaaaggtcatattcctccaataaaaacacga
aagacttgtattagaagtggtataattgctactggtagtccatgtccaatatgcagagat
gaatatttagttcttgattatcgtaatgttgatttattaaaacaatttatttctaaagat
actggagaaattttaaattatgattatacttctctttgtcaaaaggcttataaagatcta
cttgttgcaataatgaaatcaagagaatatggtttatttccatatcatgttccttttaga
tattatgattattcagaatggaaaaattaa

DBGET integrated database retrieval system