KEGG   Apis mellifera (honey bee): 552526Help
Entry
552526            CDS       T01057                                 

Gene name
mRpS18B, GB13631
Definition
mitochondrial ribosomal protein S18B
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
ame  Apis mellifera (honey bee)
Brite
Ribosome [BR:ame03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    552526 (mRpS18B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG10
AA seq 477 aa AA seqDB search
MNEEKLNCTFLIVGGGIAGVSCVESIAFLAPEEKIILITASPLIKTVTNIIPLGKTLMQF
DIEEKDSTVLMKVHDLLKIINDLVIKIDSLNKQVETKTGKIINYKMLCLCNGARPKLIEN
YNNFILGIRDTESVLQFSQKIKNSKRIVIVGNGGIATEIVHEVDGLEMIWVIKDKHISAT
FVDPGASEFFMNKIYKNDIFVNANKSSLTKRMRYTVSDITAVADGPALGPDWHNNFNIKS
TYLKSAKVQIEYECEIIKILNKSEQKEFDPMEEWPIYVQLTNGKIIGCDFIVSATGVIPN
SDIIGLEDIKKEKDGGLLVDWKLETSKQDIYAAGDVCSAGWVLAKHWFQMRLWTQAHQMG
RYAAKSMVSKMKNEEFLQDFCFELFTHVTKFFGYKVVLLGLYNGQKLDNNYEVLLRTTKG
EEYIKLILKNGKMQGAVLIGDTNLEEMCENLILNQLDLSIYGEDLLNPAIDIEDYFD
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagaaaagttaaactgtacatttttaatagtaggtggtggtattgctggagta
tcttgtgttgaaagtatagcttttcttgctccagaagaaaaaatcattttaattacagca
agtcctttaataaaaacagtcacaaatataattccacttggtaaaactttaatgcaattt
gatatagaagaaaaagatagtacagttttgatgaaagtacatgatttattaaaaattata
aatgatttagtaataaaaatagatagtttaaataaacaagtggaaactaaaactggaaaa
attataaattataaaatgttatgtctttgtaatggtgctagaccaaaacttatagaaaat
tataataattttatactaggtataagagatactgaatcagttcttcaattttctcaaaaa
ataaagaattcaaaaagaattgtaatagttggaaatggaggtattgcaactgaaattgtg
catgaagtagatggtcttgaaatgatatgggtaatcaaggataaacatatttctgcaact
tttgttgatcctggagcttcagaatttttcatgaacaaaatatacaaaaatgatatattt
gtaaatgctaataaaagttctttaactaaaagaatgaggtatactgtctctgatattacc
gctgtagcagatggaccagctttaggtccagattggcataacaattttaatataaaaagt
acttaccttaaatctgcaaaagtacaaatagaatatgaatgtgaaataattaaaattctt
aataaatcagaacaaaaagaatttgatcctatggaagaatggcctatatatgttcaatta
acaaatggaaaaattattggttgtgatttcattgtatcagcaactggtgtaattccaaat
tctgatataataggtttggaagatataaaaaaggagaaagatggaggattattggtagat
tggaaattagaaacttctaaacaagatatatatgctgctggagatgtatgtagtgcagga
tgggtattagcaaaacattggtttcaaatgagattatggactcaagcacatcaaatgggt
cgatatgcagcaaaatcaatggtttctaaaatgaaaaatgaagagtttctacaagatttt
tgttttgaactttttactcatgtaactaagttttttggttacaaagtagttttacttggt
ttgtataatggacaaaagttggataataattatgaagtattattacgaacaactaaagga
gaagaatatataaaacttatattaaaaaatggtaaaatgcaaggagcagttttaattgga
gatactaatttagaagaaatgtgcgagaatttaatacttaatcaattagatttaagtatc
tatggagaagatttattgaatcctgctattgatattgaagattattttgattaa

DBGET integrated database retrieval system