KEGG   Apis mellifera (honey bee): 552556Help
Entry
552556            CDS       T01057                                 

Gene name
GB18459
Definition
arginase-1-like
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ame  Apis mellifera (honey bee)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    552556 (GB18459)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    552556 (GB18459)
Enzymes [BR:ame01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     552556 (GB18459)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG10
AA seq 312 aa AA seqDB search
MNSLRKIQSVIIRLGNRYYKKLGIIGVPFEKGQHKKGVAQGPEAIRKAGLMKELELLGDV
AGCTSKLSEQFQQILKKDRRILTLGGDHSLGIGTIDGHVKEKGDIALIWVDAHADLNTNK
TSTTGLFHGMPVALLTSELADYWPHLPGMDWQKPMLSIRNVAYIGLREVDSYERLVIEKF
GITAFGMEDIERYGIHDVTYMALSKIDPNDSRSIHVSFDIDSLDPLEAPCTGTPVRGGLS
LREAIHLMEVLYRTKRLNALDIVEINPYIGNKYDVQLTIGAAIHIIQAGFGYSRRGLRVP
EGVTDIPLPTVK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaattcattaagaaaaatacaaagtgttattattagactaggaaatcgatattacaaa
aaacttggaattattggagtaccatttgaaaaaggccagcataagaaaggtgtagcacaa
ggtccagaagcaattagaaaagctggattaatgaaagaattggaattattaggtgatgtt
gctggttgtacaagcaaattatctgaacaatttcaacaaattttgaagaaagatcgaaga
atattaactcttggtggtgatcatagtctaggaattggaactatagatggtcatgttaag
gaaaaaggagatatagctttaatatgggttgatgctcatgcagatttaaatacaaataaa
actagcactactggattatttcatggaatgcctgtagcattattaacttctgaattggct
gattattggccacatcttccaggaatggattggcaaaaaccaatgctgtctatcagaaat
gttgcttacattggattaagagaagttgatagttatgaaagactagttattgagaaattt
ggtattactgctttcggtatggaagatatagagagatatggtattcatgatgttacttat
atggcattaagtaaaatagatcctaatgattcaagatcaatacacgttagtttcgatatt
gattcattagatcctttggaagcaccgtgtacaggaactcctgtacgtggtggattatca
ttaagagaagctattcatttaatggaagttctctatagaactaaaagattaaatgcatta
gatattgtagaaataaatccttatattggtaataaatatgatgttcaattaactattgga
gctgccatacatattattcaagctggctttggatatagtagaagaggtcttagagttcca
gaaggtgttacagatataccattaccaacagttaaataa

DBGET integrated database retrieval system