KEGG   Apis mellifera (honey bee): 552556Help
Entry
552556            CDS       T01057                                 

Gene name
GB18459
Definition
arginase-1-like
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ame  Apis mellifera (honey bee)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ame01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ame00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG10
AA seq 312 aa AA seqDB search
MNSLRKIQSVIIRLGNRYYKKLGIIGVPFEKGQHKKGVAQGPEAIRKAGLMKELELLGDV
AGCTSKLSEQFQQILKKDRRILTLGGDHSLGIGTIDGHVKEKGDIALIWVDAHADLNTNK
TSTTGLFHGMPVALLTSELADYWPHLPGMDWQKPMLSIRNVAYIGLREVDSYERLVIEKF
GITAFGMEDIERYGIHDVTYMALSKIDPNDSRSIHVSFDIDSLDPLEAPCTGTPVRGGLS
LREAIHLMEVLYRTKRLNALDIVEINPYIGNKYDVQLTIGAAIHIIQAGFGYSRRGLRVP
EGVTDIPLPTVK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaattcattaagaaaaatacaaagtgttattattagactaggaaatcgatattacaaa
aaacttggaattattggagtaccatttgaaaaaggccagcataagaaaggtgtagcacaa
ggtccagaagcaattagaaaagctggattaatgaaagaattggaattattaggtgatgtt
gctggttgtacaagcaaattatctgaacaatttcaacaaattttgaagaaagatcgaaga
atattaactcttggtggtgatcatagtctaggaattggaactatagatggtcatgttaag
gaaaaaggagatatagctttaatatgggttgatgctcatgcagatttaaatacaaataaa
actagcactactggattatttcatggaatgcctgtagcattattaacttctgaattggct
gattattggccacatcttccaggaatggattggcaaaaaccaatgctgtctatcagaaat
gttgcttacattggattaagagaagttgatagttatgaaagactagttattgagaaattt
ggtattactgctttcggtatggaagatatagagagatatggtattcatgatgttacttat
atggcattaagtaaaatagatcctaatgattcaagatcaatacacgttagtttcgatatt
gattcattagatcctttggaagcaccgtgtacaggaactcctgtacgtggtggattatca
ttaagagaagctattcatttaatggaagttctctatagaactaaaagattaaatgcatta
gatattgtagaaataaatccttatattggtaataaatatgatgttcaattaactattgga
gctgccatacatattattcaagctggctttggatatagtagaagaggtcttagagttcca
gaaggtgttacagatataccattaccaacagttaaataa

DBGET integrated database retrieval system