KEGG   Apis mellifera (honey bee): 552646Help
Entry
552646            CDS       T01057                                 

Gene name
KAT2A, GB19492
Definition
(RefSeq) K(lysine) acetyltransferase 2A (EC:2.3.1.48)
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ame  Apis mellifera (honey bee)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:ame00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    552646 (KAT2A)
Enzymes [BR:ame01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     552646 (KAT2A)
Transcription machinery [BR:ame03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     552646 (KAT2A)
Chromosome [BR:ame03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    552646 (KAT2A)
   HAT complexes
    PCAF complex
     552646 (KAT2A)
    STAGA complex
     552646 (KAT2A)
    TFTC complex
     552646 (KAT2A)
    SAGA complex
     552646 (KAT2A)
    SLIK complex
     552646 (KAT2A)
    ADA-HAT complex
     552646 (KAT2A)
    HAT-A2 complex
     552646 (KAT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG16
AA seq 811 aa AA seqDB search
MTTEEGNRNLTLQSLEENGVTSTSQHAGNSREPNTARSQEQSSRQNNLQRIQQRKQQMLN
LPQMKKILKIATYSVCKVDDCKCIGWKNSQIITKSKNDSQQPVINFFDPCKSCKHVLENH
VSHLTNQSEEEINKLLCMVIDADNIFLGLQKEEDPDTKKVYFYLYKLLRKCIQSMTKPVI
EGPLGQPPFERPSIAKAVMNFVAYKYGHLPQRDMQAMCDMAKMFLHCLNHWNFDPLSARR
GTISAEEAPAYKINHTRWLVFCHIPAFCDSLPHYDTSLVFGRTFVQAVFKPVSRQLLDKC
HSERDKLAPEKRVIVLTHFPKFLSMLETEIYSDNSPIWDPDYKQIPPTYLQSALESKANQ
TRRTGEFEKVTVPPNDKDNYTTINISPGIKKIHEKRSHSEGRSDVKRRKNEEIFEDLSEE
TVAEIVATINDPNYMCGPDAVFPPNPPRDETAKIEESRKIIEFHVVGNSLTQPVSKQSML
LLIGLHNVFSHQLPKMPKEYISQLVFDPKHKTLVLIKDGRPIGGICFRMFPTQGFTEIVF
CALTSEEQVKGYGTHLMNMLKDYHTKNNILHFLTFADEFAIGYFKKQGFSKDIKLSRSIY
QGYIKDYEGATLMHCELNAKIIYTEFTTVIRKQKEIIKKLIHQRQQEIQKVHPGLTCFKE
GVRGIPVESIPGICETGWKNYAQTRTRGVAKGTQGPEPMEACLDITDSLYNALKNVLNSV
KNHSTAWPFLKPVDKNDVPDYYDHIIYPMDLKTMTERLKARYYVTRRLFIADMTRIFTNC
RLYNTPDTEYYRCANALEKYFQTRMKEIGYL
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagaagaaggaaatcgtaacttaacattacaatcattagaagaaaatggtgta
actagtacatcacaacatgcaggaaatagtagagaaccaaatactgccagatctcaggaa
caaagtagccgacaaaataatctgcaaagaatacaacaaagaaagcaacaaatgttaaat
ttaccacaaatgaaaaaaatattaaaaattgcaacatatagtgtatgtaaagttgatgat
tgcaagtgtattggatggaagaattctcaaataataactaaatctaaaaatgattcacaa
caacctgttataaatttttttgatccttgtaaaagttgtaaacatgttttagaaaatcac
gtttcacatttaactaatcaatcagaagaagaaatcaataaattattatgtatggtcata
gatgctgataatatttttctaggattacaaaaagaagaagatcctgatacaaaaaaggtt
tatttctatttatataaacttttgagaaaatgtatacaatctatgactaaacctgtaata
gaaggtcctttaggacaaccaccttttgaacgacctagtattgcaaaagcagtaatgaat
tttgttgcttacaaatatggtcatttaccacaaagagatatgcaagctatgtgtgatatg
gcaaagatgtttttacattgcttaaatcattggaactttgatcctcttagtgctaggaga
ggtacaatcagtgcagaggaagctcctgcatataaaatcaatcatactcgttggcttgtg
ttctgtcatataccggcattttgtgactcattacctcattatgatacatctctagttttt
ggacgaacatttgttcaggctgtttttaagcctgtttctagacaattattagataaatgt
catagtgagcgagataaattggcaccagaaaaaagagtaatagtattaacacattttcct
aaattcttatcaatgttagaaacagaaatttattctgataattcaccaatttgggatcct
gattataaacaaatacctcctacttatttacaatctgctttggaatcaaaagcaaatcaa
acaagaagaacaggtgaatttgaaaaagtcactgttccaccaaatgataaagataattat
acaacaattaatataagtcctggtataaaaaagattcacgaaaaaagatcacattctgaa
ggtcgttcagatgtaaaaagaagaaaaaatgaagaaatttttgaagatttatcagaagaa
acagttgctgaaattgttgcaaccattaatgatcctaattatatgtgtggacctgatgca
gtatttccaccaaatcctccacgagatgaaactgctaaaattgaagaaagcagaaagatt
atagaatttcatgtagttggaaacagtttaacacaaccagtttctaagcaatcaatgctt
ttgttaattggattacataatgtatttagccatcaattacctaaaatgccaaaagaatat
atatctcaattagtttttgacccaaagcataaaacattagtcctaataaaagatggtcga
ccaattggtggtatctgttttcgaatgtttcccactcaaggttttacagaaatagtattt
tgtgctcttaccagtgaagaacaagttaaaggctatggtacacacttaatgaacatgctt
aaagattatcatacaaaaaataatatattacattttcttacatttgcggatgaatttgca
attggatatttcaaaaaacaaggatttagtaaagatataaaattatctcgatcgatatat
caaggatatattaaggattatgagggtgcaacattaatgcattgtgaattaaatgcaaaa
attatatatactgaattcacgactgttatacgaaaacaaaaagaaattattaaaaagcta
attcatcaaagacaacaggaaatacaaaaagtccatcctggtttaacatgtttcaaagaa
ggtgttagaggaattccagtagagtctattcctggtatttgtgaaactggttggaaaaat
tatgctcagacaagaacaagaggagtggctaaaggaactcaaggaccagaaccaatggaa
gcatgcttagatatcacagattctttatataatgcattaaaaaatgttttaaatagtgta
aaaaaccacagtacagcatggccatttttaaagcctgtggataaaaatgatgtgccagat
tattatgatcatattatatatccaatggatctcaaaactatgactgaacgattaaaagct
agatattatgttacaagaagattatttattgcagatatgacaagaatttttactaattgt
cgtttatataacactcctgatactgaatattatcgatgtgctaatgctttagaaaaatat
ttccaaacaagaatgaaagaaattggatatctttag

DBGET integrated database retrieval system