KEGG   Apis mellifera (honey bee): 552646Help
Entry
552646            CDS       T01057                                 

Gene name
KAT2A, GB19492
Definition
K(lysine) acetyltransferase 2A (EC:2.3.1.48)
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ame  Apis mellifera (honey bee)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:ame00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    552646 (KAT2A)
Enzymes [BR:ame01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     552646 (KAT2A)
Transcription machinery [BR:ame03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     552646 (KAT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG16
AA seq 811 aa AA seqDB search
MTTEEGNRNLTLQSLEENGVTSTSQHAGNSREPNTARSQEQSSRQNNLQRIQQRKQQMLN
LPQMKKILKIATYSVCKVDDCKCIGWKNSQIITKSKNDSQQPVINFFDPCKSCKHVLENH
VSHLTNQSEEEINKLLCMVIDADNIFLGLQKEEDPDTKKVYFYLYKLLRKCIQSMTKPVI
EGPLGQPPFERPSIAKAVMNFVAYKYGHLPQRDMQAMCDMAKMFLHCLNHWNFDPLSARR
GTISAEEAPAYKINHTRWLVFCHIPAFCDSLPHYDTSLVFGRTFVQAVFKPVSRQLLDKC
HSERDKLAPEKRVIVLTHFPKFLSMLETEIYSDNSPIWDPDYKQIPPTYLQSALESKANQ
TRRTGEFEKVTVPPNDKDNYTTINISPGIKKIHEKRSHSEGRSDVKRRKNEEIFEDLSEE
TVAEIVATINDPNYMCGPDAVFPPNPPRDETAKIEESRKIIEFHVVGNSLTQPVSKQSML
LLIGLHNVFSHQLPKMPKEYISQLVFDPKHKTLVLIKDGRPIGGICFRMFPTQGFTEIVF
CALTSEEQVKGYGTHLMNMLKDYHTKNNILHFLTFADEFAIGYFKKQGFSKDIKLSRSIY
QGYIKDYEGATLMHCELNAKIIYTEFTTVIRKQKEIIKKLIHQRQQEIQKVHPGLTCFKE
GVRGIPVESIPGICETGWKNYAQTRTRGVAKGTQGPEPMEACLDITDSLYNALKNVLNSV
KNHSTAWPFLKPVDKNDVPDYYDHIIYPMDLKTMTERLKARYYVTRRLFIADMTRIFTNC
RLYNTPDTEYYRCANALEKYFQTRMKEIGYL
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagaagaaggaaatcgtaacttaacattacaatcattagaagaaaatggtgta
actagtacatcacaacatgcaggaaatagtagagaaccaaatactgccagatctcaggaa
caaagtagccgacaaaataatctgcaaagaatacaacaaagaaagcaacaaatgttaaat
ttaccacaaatgaaaaaaatattaaaaattgcaacatatagtgtatgtaaagttgatgat
tgcaagtgtattggatggaagaattctcaaataataactaaatctaaaaatgattcacaa
caacctgttataaatttttttgatccttgtaaaagttgtaaacatgttttagaaaatcac
gtttcacatttaactaatcaatcagaagaagaaatcaataaattattatgtatggtcata
gatgctgataatatttttctaggattacaaaaagaagaagatcctgatacaaaaaaggtt
tatttctatttatataaacttttgagaaaatgtatacaatctatgactaaacctgtaata
gaaggtcctttaggacaaccaccttttgaacgacctagtattgcaaaagcagtaatgaat
tttgttgcttacaaatatggtcatttaccacaaagagatatgcaagctatgtgtgatatg
gcaaagatgtttttacattgcttaaatcattggaactttgatcctcttagtgctaggaga
ggtacaatcagtgcagaggaagctcctgcatataaaatcaatcatactcgttggcttgtg
ttctgtcatataccggcattttgtgactcattacctcattatgatacatctctagttttt
ggacgaacatttgttcaggctgtttttaagcctgtttctagacaattattagataaatgt
catagtgagcgagataaattggcaccagaaaaaagagtaatagtattaacacattttcct
aaattcttatcaatgttagaaacagaaatttattctgataattcaccaatttgggatcct
gattataaacaaatacctcctacttatttacaatctgctttggaatcaaaagcaaatcaa
acaagaagaacaggtgaatttgaaaaagtcactgttccaccaaatgataaagataattat
acaacaattaatataagtcctggtataaaaaagattcacgaaaaaagatcacattctgaa
ggtcgttcagatgtaaaaagaagaaaaaatgaagaaatttttgaagatttatcagaagaa
acagttgctgaaattgttgcaaccattaatgatcctaattatatgtgtggacctgatgca
gtatttccaccaaatcctccacgagatgaaactgctaaaattgaagaaagcagaaagatt
atagaatttcatgtagttggaaacagtttaacacaaccagtttctaagcaatcaatgctt
ttgttaattggattacataatgtatttagccatcaattacctaaaatgccaaaagaatat
atatctcaattagtttttgacccaaagcataaaacattagtcctaataaaagatggtcga
ccaattggtggtatctgttttcgaatgtttcccactcaaggttttacagaaatagtattt
tgtgctcttaccagtgaagaacaagttaaaggctatggtacacacttaatgaacatgctt
aaagattatcatacaaaaaataatatattacattttcttacatttgcggatgaatttgca
attggatatttcaaaaaacaaggatttagtaaagatataaaattatctcgatcgatatat
caaggatatattaaggattatgagggtgcaacattaatgcattgtgaattaaatgcaaaa
attatatatactgaattcacgactgttatacgaaaacaaaaagaaattattaaaaagcta
attcatcaaagacaacaggaaatacaaaaagtccatcctggtttaacatgtttcaaagaa
ggtgttagaggaattccagtagagtctattcctggtatttgtgaaactggttggaaaaat
tatgctcagacaagaacaagaggagtggctaaaggaactcaaggaccagaaccaatggaa
gcatgcttagatatcacagattctttatataatgcattaaaaaatgttttaaatagtgta
aaaaaccacagtacagcatggccatttttaaagcctgtggataaaaatgatgtgccagat
tattatgatcatattatatatccaatggatctcaaaactatgactgaacgattaaaagct
agatattatgttacaagaagattatttattgcagatatgacaagaatttttactaattgt
cgtttatataacactcctgatactgaatattatcgatgtgctaatgctttagaaaaatat
ttccaaacaagaatgaaagaaattggatatctttag

DBGET integrated database retrieval system