KEGG   Apis mellifera (honey bee): 552660Help
Entry
552660            CDS       T01057                                 

Gene name
GB17494
Definition
ubiquitin carboxyl-terminal hydrolase 46-like
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     552660 (GB17494)
Peptidases [BR:ame01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   552660 (GB17494)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG1
AA seq 327 aa AA seqDB search
MGANISQLERDIGSDQFPPNEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKARNK
RTKETLLTCLADLFYSIATQKKKVGSIAPKKFIARLRKEKAERSQSKPAGGKCGAGDAGS
PPEPTWVHEIFQGILTSETRCLNCETVSSKDEDFFDLQVDVDQNTSITHCLRCFSNTETL
CSDNKFKCDHCSSYQEAQKRMRVKKLPMILALHLKRFKYVEQYNRHIKVSHRVVFPLELR
LFNTSDDAVNPDRLYDLVAVVIHCGSGPNRGHYISIVKSHGFWLLFDDDMVDKIDASTIE
DFYGLTSDIQKSSETGYILFYQSIDCN
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcaaatatatcacaattagagagagatattggctctgatcaatttcctcctaat
gaacactattttggattagttaattttggaaatacctgttatagcaattctgtattacaa
gctttatatttttgtcgaccatttagagaaaaagttttagaatataaagctagaaataag
agaaccaaggaaacgttattaacatgcttagccgatttgttttatagtattgcaactcaa
aaaaagaaagttggatctatagctccaaaaaagtttattgccagattaaggaaagaaaaa
gcagagagaagtcaaagtaaaccagcaggaggaaaatgtggtgcaggtgatgctggttca
ccaccagaacctacatgggttcatgaaatatttcaaggaattctgacatcagaaacacgt
tgccttaattgtgagactgtatctagcaaagatgaggatttctttgatttacaagttgat
gtagatcaaaatacttcaatcacacactgcctcagatgtttttcaaatactgagacactt
tgtagtgataacaaattcaaatgtgatcattgtagtagttatcaagaagcccagaaacga
atgagagttaaaaaattaccaatgatactagcattgcatctaaagagatttaaatatgtg
gaacaatataatcgtcacatcaaggtttcccatagagtagtttttcctttagaacttcga
ctattcaatactagtgatgatgcagtgaatccagatagattatatgatttggtagcagtt
gtaatacattgtggaagtggacctaatcgaggacattatatttccatagttaaaagccat
ggattttggttgctttttgatgatgacatggttgataaaattgatgcatctacaatagaa
gacttttatggactcacgtctgatattcagaaaagttctgaaactggctatatcttattc
tatcaatcaatagattgtaattag

DBGET integrated database retrieval system