KEGG   Apis mellifera (honey bee): 552694Help
Entry
552694            CDS       T01057                                 

Gene name
PTP-ER, GB10766
Definition
protein tyrosine phosphatase-ERK/Enhancer of Ras1
Orthology
K04458  
receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     552694 (PTP-ER)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG12
AA seq 565 aa AA seqDB search
MEKYNIDANMRQCFDGVLVHGGTSTPLTNHYVNDANYYEISSNDDNSNPLEKFYLITGQR
WHTDTVLPIPLLPSTEGMSARSHHRYQLFIHRIPQSITGLDDAGMDLQAAQLSTRTGQEV
RSTATLSWLDWQLSLFVAVCAIGGVILFTFLILLWLRKQMSREKDTEDGDRRGLVEEGAV
GHPEKSIKSSKGSIEWVHQPATKSSVQSVPTRSLTQAIGLPEVMSVATPERRPEPIRIRT
KGLLERRGSSASLTIELAPPPESPPHIVTPTRECTAEEFLLSAGNVLSRAQLRKAISDTA
SLHKEFWEVPLNLPEKLDICGSGVKNRYCSVLPNPQSRVILPGPSDDPLSSYINANYIRG
YDGEDARYIATQGPLAHTVDDFWKMVWAEKVPAIVMMTKLHEAAKTKCEAYFPLDKNNRI
QAGLFTIIVSSIDTREGYTIRDLELRYEGERKHVQHYWYDSWPDHAVPQTADTLVSLAAE
VNSLPGPVVVHCSAGIGRTGCFIALATGMTQLLRDGNVDVLGILCQMRYDRGGMVQTAEQ
YEFVHRALCLYEQTLEGGKSSSSGD
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagtataacatcgatgcaaacatgagacagtgtttcgacggagttttagtacac
ggaggaacaagtactcctttaactaatcattatgtaaatgatgcaaattattatgaaatc
tcaagcaatgatgacaattcaaatcccttggagaaattttacttaattactggacaaagg
tggcatacggatactgtgctacctattcctttattgccatctacagagggaatgtctgct
cgatctcatcacagatatcaactttttatacataggatcccacagtccataacgggactg
gatgatgctggaatggatttgcaagcagctcaactcagtacccgcacaggacaggaggta
cgttccactgcaaccttatcatggctagattggcaattgtccctgttcgtagcagtttgc
gccatcggtggcgtcattctctttacatttctgattttgttatggctgcggaaacaaatg
tcgcgtgaaaaagataccgaagatggtgataggagaggtttggtagaggaaggtgctgtg
ggtcatccggaaaaatctataaaatcttcaaaaggatcgattgaatgggttcatcaaccc
gcaacgaaatcatcagttcaatctgttcctactcgatctctcacgcaagccattggttta
ccagaagtaatgtcagtagcgactccagaacgcagaccggaaccgatacggataaggact
aaaggattgttagaacgacgtggatcaagtgcaagtttgactatagaattggcaccacct
ccagaaagtccacctcatattgttacacctactcgtgaatgtactgcagaggaatttcta
ttaagcgctggaaacgttttatcaagagcacaacttagaaaggcaatcagtgacacggcg
tcgttacataaagaattttgggaagttcctcttaatttaccagagaaattagatatatgt
ggatctggggtgaagaatagatattgttccgtattaccaaatccacaatcaagagtgatt
ttaccgggtccttctgacgatcctctttcaagttatattaatgccaattatattcgggga
tatgatggagaagatgcacgctatattgcaacacagggaccattagctcacactgtggat
gatttttggaaaatggtctgggcagaaaaagtacccgcgatagttatgatgacgaaatta
cacgaagccgccaaaacaaaatgcgaagcatattttccattggataaaaataatcgcata
caggctggactgtttactattattgttagttctattgatacaagagaaggatatacgatc
agagatttggaacttcgatatgaaggcgaaagaaagcatgtgcagcattactggtatgat
tcatggccagaccatgccgtacctcaaacggcggatacccttgttagtttagctgcagaa
gtaaattctttaccaggtccggtcgttgttcattgtagtgctggaattggacgaactggt
tgtttcatagctttagctacgggaatgacgcagttattacgagatgggaatgtagatgta
ttgggtattttatgccaaatgagatatgacagaggtggtatggttcagacagcagaacaa
tacgaattcgttcatcgtgcactttgtctgtatgaacagacacttgaaggtggtaaatca
tcaagttcaggtgattga

DBGET integrated database retrieval system