KEGG   Apis mellifera (honey bee): 552696Help
Entry
552696            CDS       T01057                                 

Gene name
mof, GB15903
Definition
males absent on the first
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     552696 (mof)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG5
AA seq 376 aa AA seqDB search
MAESEQRNKENCIVGSKEMMVKQEKRENTLTNGGKGSGDDADSLEELPLDIGEHYLVRRS
DDSWHPAEIIQTRYNESESHYEYYVHYEGHNRRLDEWVPRDRIMSSRFDMSDRSWKSGDR
NSGTDLLADSSDRKITRNQKRRHDEINHIQKTYAEMDPTTAALEKEHEAITKVKYIDKIQ
IGKYEIDTWYFSPYPEEYGKQPKLWICEYCLKYMRLEKTYRYHMSECTHRQPVGKEIYRK
GTLSIWEVDGREHKIYCQNLCLLAKLFLDHKTLYFDVEPFLFYILCEVDKHGAHLVGYFS
KEKESPDGNNVACILTLPPFQRQGYGKLLIAFSYELSRIEQTVGSPEKPLSDLGKLSYRS
YWSWILLEILRDFRVK
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggccgaatcggaacaaaggaacaaagagaattgtattgtaggatcaaaagaaatgatg
gtgaagcaagaaaagcgtgagaatacgttgacaaatggcgggaaaggatctggggatgac
gcggacagtctcgaagaattacctcttgatattggtgaacactatcttgttcgcagatct
gatgattcctggcatccagcagaaattattcaaactcgatataatgagagtgaaagccat
tatgaatattatgttcattatgaaggacataatagaagattggatgaatgggtgcctagg
gatagaattatgtcaagtagatttgatatgagtgatagaagttggaaaagtggagacaga
aattctggtactgatttactggcagattcatcagatcgtaagattacaagaaatcaaaaa
agaagacatgacgaaattaatcacattcaaaagacatatgctgaaatggatcctacaact
gctgcactagaaaaagaacatgaagcaataacaaaagtcaaatacattgataagattcaa
ataggaaagtatgaaattgatacttggtactttagtccatatccagaagagtatggcaaa
caaccaaaactatggatttgtgaatattgtcttaaatacatgcgtcttgaaaaaacttat
agatatcacatgagtgaatgtacacatagacaaccagttggcaaagaaatatatcgcaaa
ggcacattaagtatttgggaagtggatggtagagagcataaaatttattgtcaaaattta
tgcttacttgcaaaattgtttttagatcataaaacactttattttgatgttgaaccattt
cttttttatattctttgtgaagttgataaacatggggctcatttagttggttatttttca
aaggagaaagaatcacctgatggtaataatgttgcttgcattttaactttaccgccgttt
caaagacaaggatatggaaaacttttaatcgcttttagttacgaattaagcagaatagaa
caaactgttggtagtcctgaaaaacccctaagtgatttaggaaaattatcatatagaagt
tactggagttggattcttttagaaattttgcgggattttcgagtcaaatga

DBGET integrated database retrieval system