KEGG   Apis mellifera (honey bee): 552748Help
Entry
552748            CDS       T01057                                 

Definition
(RefSeq) histone acetyltransferase type B catalytic subunit
  KO
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     552748
Chromosome [BR:ame03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    552748
   HAT complexes
    HATB complex
     552748
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG5
AA seq 409 aa AA seqDB search
MEDPTTARLKSLVMSSNEALEFKLIRSFEDLENNETTFKPEMSHQVFGDSESIFGYRDLR
VKLYYSAGCLETYLGMTYSEKINKVLYEGVEADEVLPKIAEKLAPQVHDNIDAFIESLKK
DDTFKPHGELLHSFSVNDDGCTRKFEVYKADMSYKGFKEYHQRLQTFVLWYIDAANFIDI
DDDRWHYFNMFEKYQTTDGTVRYATTGFATVYQYYAYPHHTRPRIAQVLILPPFQNIGLG
THLLHAIYREYIGRNQVKDITVEDPSMTFQRLRDYVDAMNCCTLSSFSREYLLQGFNKAM
AAEAKEKFKINKKQARRVYEILRLRTTDLTNEQEYREYRLDVKRRLNIPYRREQNDLKKL
ECALKNIDKHSNITLPTLEQRIQTLEKEYKSLEEEYKKVIKRLEDAEEL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggaagatccaactactgcacgtttaaaaagtttagtaatgagtagtaatgaagctttg
gaatttaaattaatacgttcttttgaagatttagaaaataatgaaactacatttaaacca
gaaatgtctcatcaagtatttggagatagtgaatctatatttggttaccgagatctcaga
gtgaagctatattattcagcaggttgtttagaaacttatctaggcatgacttattcagaa
aaaataaataaagtactttatgaaggagtcgaagctgatgaagtattgccaaaaattgct
gaaaaactagctccacaagttcatgataatatagatgcatttattgaatctttaaaaaaa
gatgatacatttaaacctcatggagaattacttcattcattttctgttaatgatgatggt
tgcacaagaaaatttgaagtttataaagcagatatgagttataaaggatttaaggaatat
catcaacgtcttcaaacatttgtattatggtatatagatgctgctaattttatagatatt
gatgatgatcgatggcattactttaatatgtttgaaaaatatcaaacaacagatggtact
gttcgttatgcaactactggttttgctactgtatatcaatattatgcatatccacatcat
actagacctcgtatagctcaagttttaattttgccaccatttcaaaatataggtcttggt
acacatttattacatgctatttatcgcgaatatattggacggaatcaagtcaaagatata
acagttgaggacccttcaatgacctttcagcgattaagagattatgtggatgcaatgaat
tgctgtacattatctagtttttcacgagagtatctacttcaaggttttaataaagcaatg
gccgcagaagctaaagaaaaattcaaaattaataagaaacaagctcgcagagtgtacgaa
attttaagattgcgaactacagatttaacaaatgaacaagaatatcgtgaatatagatta
gatgtaaaaagaagattgaatattccatatagacgagaacaaaatgatttaaaaaaattg
gaatgtgcattaaagaatattgacaaacattcgaatattactttacctacattggaacaa
cgtatacaaactctggagaaagaatataaaagtttagaagaagaatataaaaaagtgatt
aaacgtttggaagatgcagaagaactttga

DBGET integrated database retrieval system