KEGG   Apis mellifera (honey bee): 552823Help
Entry
552823            CDS       T01057                                 

Gene name
GB12048
Definition
malonyl-CoA decarboxylase, mitochondrial-like
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
ame  Apis mellifera (honey bee)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    552823 (GB12048)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    552823 (GB12048)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    552823 (GB12048)
Enzymes [BR:ame01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     552823 (GB12048)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
Un
AA seq 496 aa AA seqDB search
MHLKILINIYNNTFILKYNTTPKILKLFLTQNLRDISTFCENNIFEEQLKEVFKFKNSNV
SNWIIENKARTLCNAYQESNKKDKEQILRILAFRYAVEHTVVCNVAEKYVSTESDNKRRM
ISYERNLRNVLTPDYQWLFIMIGRLENGVKFLVDLRTDILELILKIKDTDESIAIQQLNI
TLRDLLLLWFSVGFLYLERITWQTSCDILQKISDYEAIHPIKNWLDLKQRVGPYRRCYIF
THLSMPREPLVVLHTALCDIIPDSVKDIDGAKVRILGNLKKEITFLEEDKNKIKTAIFYS
ITSTQKGLQGIELGNYLIKEVAKEVISEFPMIHELSSLSPIPNFRTWFLEKIKQDIYNIF
TNEECNSIQEILKEKDIAFGLKKILNNSLWTHNIKISEVLKKPLLRACAWYLYKEKRRNY
ALDSVANFHLRNGAVMWRINWLADPSPRGVGNSCGIMVNYRYYLHECEKHSQNYIENYFI
NASEDIINLSTQYKKL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgcacttgaaaattttaattaatatttacaataatacatttattttaaaatataataca
acaccaaagattttaaaattgtttcttacacaaaatctacgtgatatttctacattttgt
gaaaataatatttttgaagaacaattaaaagaagtttttaaatttaaaaatagtaatgtt
agcaattggattattgagaataaagctcgtactttatgtaatgcatatcaagaaagcaat
aaaaaagataaggaacaaattctacgtattttagcatttagatatgctgttgaacatact
gttgtatgtaatgtagcagaaaaatatgtatctacagagtctgataataaaagacgtatg
atttcttatgaacgaaatttaagaaatgttttaacaccagattatcaatggttgtttatt
atgattggaagacttgaaaatggtgtgaaatttcttgttgatttaaggacagatatatta
gaattaatattaaaaattaaagatacagatgaaagtattgcaatacagcaattgaatatt
actctacgagatttattattactttggttttcagtaggattcttatatttagaaagaatt
acatggcaaacttcatgcgatattttacaaaagatttcagattatgaagcaatacatcct
ataaaaaattggttagatttaaaacaaagagttggaccatatagaagatgttacattttc
actcatttatctatgccacgagaacctcttgttgtattacatacagcattatgtgatatt
ataccagatagtgtaaaagatattgatggagcaaaagtcagaattcttggtaatctaaaa
aaagagataacatttttagaagaagataaaaacaaaataaaaactgcaatattttattca
ataacttccacacagaaaggattacaaggtattgaacttggtaattatttaataaaagaa
gtggcaaaagaagtgatatcagaatttcctatgattcatgaattatcttcattatcacca
atacctaactttagaacatggtttttggaaaaaataaaacaagatatatataatattttc
acaaatgaagaatgtaattctatacaagaaattttaaaagaaaaagatatagcttttggt
ttaaaaaaaattttgaataattcattatggactcataatattaaaataagtgaagtttta
aaaaagccattacttcgagcatgtgcttggtatttatataaagaaaaaagacgaaattat
gctttagatagtgttgcaaactttcatcttcgtaatggagctgttatgtggagaataaat
tggttggctgatccttcaccacgtggtgttggaaacagttgtggaattatggtaaactat
agatactatctacatgaatgtgaaaaacatagtcaaaattatattgaaaattattttata
aatgcttctgaagatataattaatctctcaacacagtataaaaaattatga

DBGET integrated database retrieval system