KEGG   Apis mellifera (honey bee): 724159Help
Entry
724159            CDS       T01057                                 

Definition
(RefSeq) histone acetyltransferase KAT6B
  KO
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     724159
Chromosome [BR:ame03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    724159
   HAT complexes
    MOZ/MORF complex
     724159
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BEEBASE: 
Position
LG14
AA seq 1537 aa AA seqDB search
MDEPESADTWSAWFLDAIRKIRSQKQRPSVERICHAIRQHHNYHEEEIAEHLEVAVKRGD
VLKIFNKGQSSYKDPGGLQSKPLKVGKASDLSKVLGKAVRELGEREGSTLKNIEKYIRQS
HTVEEEAEGDLRTALRLSAKRAVDRGLVIQDGRLFRQPDRPPYLKKHGENAHIVPPEPPV
NKLPAPLPICRECLGATIAGNNNNTKRNVSEKLSRCNVCGAALHNSCAPPELSNLVERGI
TWSCDDCSPTCAGCQLERESQNYLVKCSGCVKCYHPTCLDPAIDKKNKIPWKCRHCQTPH
IPVSKDDNKKNKIQQDTANSLEETPTNARKRLSKLRESRKSTISRKSLTISTPVKKAGAG
VGQVDSSSDGNAGVVSPRQPPLISSPLPQPPTPLAGQGRLLEEKNDRISKEKQKFFRLSA
FNAEHNKLKRVGGSEKLKCSQNVSPRLTRGNANQKQPISSKKVLLMSSSSSSSDATDTDS
SDDTSDSTDDDDEEEEGAVRDGVREGGEEEEEVDEEPILPQSLPPGVTQKDVDLFKEARD
RAARLTTVNNTEETVTVNPGNNTSNTGNTGNGIRNPAAIVFGRYEVETWYSSPFPQEYAR
LPKLFFCEFCLKYTKSRAVLDRHMDKCQWRHPPATEIYRCDGLSVFEIDGNVNKIYCQNL
CLLAKLFLDHKTLYYDVEPFLFYAVTKNDKYGCHLVGYFSKEKHCPAQRYNVSCIMTLPQ
YQRQGFGRFLIEFSYLLSKVEGIPGTPEKPLSDLGRVSYHSFWKSVVLEYLDTHRDSTDI
KLGDITKETGVSAHDIATAMQLLGFVRSVHFPGEGNSKVAVVVDWSKVDAHMAKVRKSSR
IKLDPDCLRWIPLLTQIPNPYQSPEESGDTSSESSPVMEPKHVPTIVEKIQKVKIKKKPR
SRRLGQRRSSPLKQKTGQKSSTQKDSFTKDAKEPKEIKATKEAKEAKEPNEAKEANKDTE
KRNRNIVVATAVENIKEQMVVEAKNVASTSSRNSRAMNVSKNTNLINSTKATSLSGSTMT
TTTTTTTTTTTTTTTTVATMTTATTTMSRRRIRTPKISRYDGESVITSTTPMRKRKHSEK
LEIEEKEEKSEGSCRKRTRESLREKERDKEREKEKEKTKERDKPKDKDSYSKDKEKNDIT
EIEKFSSKAMESIMSSVVQKPTKKQCKVDDILLKVTSRQTKCLQTKQAKEKKQNNSEQNQ
CNGKDDTKDMLKTLPVSRRGRAKVEKEALKMPQLKPQTPIKDRSENPVIFPPLLSPSSCS
EEKNDSILTSKRQQSSPALEQLSIVSTEKEIDNATEKLVNSNNSTLENAHDGNTDVSKNS
SAVLPETEVTISASPGEYEGGDEDEGEEEVPALKSKSVTRVKNDSNERTENTKDNEKQEK
KLENVDIILSLQKPKSESELCVMEEEIQRKGKSENASKDNDEAEAEGENEGENENENENE
NENENQNENENENENENENENGNENENENENENEKEKEKEKENENENEKENENENENENE
KENENENENENENENENENENENENENENENENENEN
NT seq 4614 nt NT seq  +upstreamnt  +downstreamnt
atggacgaacccgagtccgctgacacgtggtcggcctggttcctggacgcaatccgaaaa
atacgcagccagaaacagaggccgagtgtcgagcggatatgtcacgcgattcgacaacac
cataattatcacgaggaggaaatcgctgaacacctggaagttgctgtaaaacgtggcgat
gtgctcaagatctttaataaaggacaatcctcgtacaaagatcctggtggcttacaatcg
aaaccgctcaaggttggcaaggcctccgatcttagtaaagtactgggtaaggctgttaga
gaattgggagaaagggagggatcaaccttgaagaacatcgaaaaatacatccgacaaagt
catacagttgaggaagaagcggaaggtgatttgagaacagcgcttagactatctgctaaa
agagcagtcgatcgaggacttgtgatacaggatggtagactttttcggcaaccggatagg
ccaccttatcttaagaaacatggagaaaacgctcatattgtgccaccggagccccctgta
aataagttgccagctccattaccgatatgcagagaatgtcttggcgcgacgatagccgga
aataataataatacaaaacgcaatgtttccgaaaaactgagcagatgtaatgtatgcggt
gcagctttacataattcttgcgcaccacctgaactttcgaatcttgttgaaagaggtata
acgtggtcttgcgacgactgttctccaacatgtgccggttgccagttagaacgggaatcg
cagaattatctagtgaaatgttccggttgcgtcaaatgttaccatcctacttgtctagat
ccagcaattgacaaaaagaataaaataccctggaaatgtcgacactgtcaaacaccgcat
ataccggtatcaaaagatgataataaaaagaataaaatacaacaggacacggcaaattcg
ctcgaagagacaccgaccaatgcaaggaagagacttagcaaattacgcgagagtagaaaa
tccacgatatcgagaaagagcctgacgatttcaactccggtgaagaaagctggcgcagga
gtgggacaggtggacagcagctcggacggtaatgcgggtgttgtctcccctcgtcaacca
cctttgatttcctctcccttaccacaaccccccaccccactcgcaggccagggtaggcta
cttgaagaaaaaaacgatcggatttccaaagagaagcaaaaattttttagactgagtgcg
tttaacgcggagcacaataaattgaagcgggtggggggcagtgaaaaattaaaatgttct
cagaacgttagtcctaggttaactcggggaaacgcgaaccaaaaacaacccatatccagt
aaaaaggtactgctaatgtctagcagtagcagcagcagcgacgcgaccgatactgattct
tccgacgacaccagtgattcgaccgacgatgacgatgaagaagaggagggagcagtcagg
gatggggtcagggaggggggagaagaggaagaggaggtggacgaggaaccgattctacct
caatctctaccgccgggtgtcacacaaaaggatgttgacctgtttaaagaagcccgggat
agagcagctcgattaaccactgtgaacaataccgaggaaactgtgacagtgaatccagga
aacaatacgagcaatacgggaaatactgggaatggcattaggaatcccgcggccatagtt
tttggtcgatatgaagtagagacatggtattccagtccatttccccaagaatacgcaaga
ttacctaaattattcttctgtgaattctgtttaaaatatacaaaaagtcgggccgtactt
gacaggcatatggataaatgccaatggaggcatccaccggctaccgaaatctacagatgt
gacggattatccgtttttgagatcgatggaaacgtgaataagatatattgtcaaaatttg
tgtctattagcaaaattattcttggatcataagacgctgtactacgatgtagaaccattt
ttattttacgcggtaacaaaaaacgataaatatggttgtcatttagttggttatttcagc
aaagagaaacattgtcccgcgcaaaggtacaatgtgtcatgtatcatgactttaccgcaa
tatcaaagacaaggattcggaaggttcttgattgaattcagttatctactgtctaaagtg
gaaggaatccctgggacgccggagaaaccattatccgatcttggccgagtatcgtatcat
tcattttggaaaagcgtggttcttgaatatctcgatactcatagagattcaacggatatt
aaattaggagatataacaaaggagactggtgtgtcagctcacgatattgcaactgctatg
caattgctgggatttgttagatcggtccatttcccgggagagggaaattctaaagtagct
gtggtagtcgattggagcaaagtggatgctcatatggcgaaagtacgaaagagttctcgt
atcaaattagatcctgattgtcttagatggataccattgctcacgcaaattcctaatcca
tatcaaagtccggaagaaagcggtgataccagttccgagtcctctcccgtcatggaaccg
aaacacgtaccaactatcgttgaaaaaattcaaaaagtaaagattaaaaagaaaccgagg
agtagaagattagggcaaagaagatcttcaccgctgaaacagaaaacgggccagaaatct
tccacgcaaaaagattcttttaccaaagatgcgaaagaaccaaaagaaataaaagcaacg
aaagaagcgaaggaagcaaaggaaccgaacgaagcgaaagaagcaaataaagatacggaa
aaaaggaatcgaaatattgttgtcgccactgcggtagaaaatattaaagaacagatggta
gtggaagcaaaaaatgttgcatcaacatcatcgaggaattctcgagcaatgaatgtttca
aaaaatacaaatttgataaattcgacgaaagcaacatccttgtcagggtcaacaatgacg
acgacaacgacgactaccacaaccaccaccaccaccactaccaccacagtagcaacgatg
actacagcaacgacaacgatgtcgagacggagaatcagaacaccgaaaatatctcgttac
gacggagaatcggtaataacgtcgacaacgcctatgcgaaaacgaaaacattccgagaaa
ctagagatcgaagaaaaagaagaaaagtctgaaggcagctgtagaaaaaggacgcgggaa
tctttgcgagagaaagagagagataaagaacgagaaaaggaaaaggagaaaacgaaagaa
cgggataagccaaaggataaagatagttactcgaaagataaagaaaagaacgatataacc
gagatagaaaagttttcttcaaaagcgatggaatcgataatgtcatcggtagtacaaaaa
ccgacgaaaaagcaatgcaaagtcgatgatattttgttaaaagtgactagccggcaaact
aaatgcttacaaacgaagcaagcgaaagaaaagaaacagaacaattcggaacagaatcag
tgtaatggaaaagacgacacaaaagatatgttgaaaactttaccagtatcgagacgggga
agagcaaaagtcgagaaagaagcattaaaaatgccgcaattgaaaccgcaaactcctata
aaagatcgatccgaaaatcctgtgatatttccaccattgttatccccttcatcgtgttct
gaagagaagaacgattctattttaacgagcaagagacaacaatcgtctcccgccttggaa
caattatcgatagtctctacggaaaaagaaattgataacgcaacagaaaaattagttaat
agcaataatagtacattggaaaatgcccatgatggtaatactgatgtctcaaagaactct
tcagccgttcttccggaaacagaagtaacaatatctgctagtccaggagaatacgaagga
ggagatgaagatgaaggcgaagaagaagtacctgcacttaaatcgaaatccgtaactcgc
gtgaaaaatgattcaaacgaaagaactgaaaatacaaaagataatgagaaacaagaaaag
aaactcgaaaatgttgatatcattctctctttacaaaaaccgaaatcggaatcagaatta
tgtgtcatggaagaagagatacagaggaaaggtaagagtgaaaatgcaagtaaagataat
gatgaggctgaagctgaaggtgaaaatgaaggcgaaaacgaaaatgagaatgaaaatgaa
aatgaaaatgaaaatcagaatgaaaatgaaaatgaaaatgaaaacgaaaatgaaaatgaa
aatggaaatgaaaatgaaaatgaaaacgaaaacgaaaacgaaaaggaaaaggaaaaggaa
aaagaaaacgaaaacgaaaacgaaaaggaaaacgaaaatgaaaatgaaaacgaaaacgaa
aaggaaaacgaaaacgaaaatgaaaacgaaaacgaaaatgaaaatgaaaacgaaaatgaa
aacgaaaatgaaaatgaaaatgaaaacgaaaatgaaaacgaaaacgaaaattga

DBGET integrated database retrieval system