KEGG   Apis mellifera (honey bee): 724159Help
Entry
724159            CDS       T01057                                 

Gene name
GB10093
Definition
uncharacterized LOC724159
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     724159 (GB10093)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG14
AA seq 2180 aa AA seqDB search
MDEPESADTWSAWFLDAIRKIRSQKQRPSVERICHAIRQHHNYHEEEIAEHLEVAVKRGD
VLKIFNKGQSSYKDPGGLQSKPLKVGKASDLSKVLGKAVRELGEREGSTLKNIEKYIRQS
HTVEEEAEGDLRTALRLSAKRAVDRGLVIQDGRLFRQPDRPPYLKKHGENAHIVPPEPPV
NKLPAPLPICRECLGATIAGNNNNTKRNVSEKLSRCNVCGAALHNSCAPPELSNLVERGI
TWSCDDCSPTCAGCQLERESQNYLVKCSGCVKCYHPTCLDPAIDKKNKIPWKCRHCQTPH
IPVSKDDNKKNKIQQDTANSLEETPTNARKRLSKLRESRKSTISRKSLTISTPVKKAGAG
VGQVDSSSDGNAGVVSPRQPPLISSPLPQPPTPLAGQGRLLEEKNDRISKEKQKFFRLSA
FNAEHNKLKRVGGSEKLKCSQNVSPRLTRGNANQKQPISSKKVLLMSSSSSSSDATDTDS
SDDTSDSTDDDDEEEEGAVRDGVREGGEEEEEVDGNNSSASNDSSTSEEDNDDDDDDNDD
DNDDDDDDEDDDDDDDDVDNDNQKKCSVIIGGGNDGGDSTIINASPKPRGPFSCDLNEDK
PWGFAAAAAKLNMESPFFSNITNTFGAPLPKLDVTSTSTFGLPVINSFDGKKKQKSNRNG
SAISESFNNVDVNKIKPGTGQLKGLFDGLSHFFSVPTNSRVRSSTLTPNYAPDRRKRPNS
DDSDNKSSKVLKGTQINKNDNLSSDLGKLKEKKKTETRNDITRIPRPGIFTPSDETLFSS
LNEKMPKMTPSNLVKTAVNSKRHEYERRKLMKDNTPLIKCATDASLPSFPSPLLSSSSSS
SSSSSSSSSSSSSSSSSMSSSSSLSSSSTFPLPLPLPLPLSLSSPLPLSLPLPLPSSLSS
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSSSSSSSSSLLSSSSSP
PSALPLSSLSSSSSSISSSSSSSMSALRPDQSSRKKNILVEVNQTRHPVPAVSRSGLSSD
SVKSNPSLKSNPRACTSATTTNTTTTPRATPCSTRKEEPILPQSLPPGVTQKDVDLFKEA
RDRAARLTTVNNTEETVTVNPGNNTSNTGNTGNGIRNPAAIVFGRYEVETWYSSPFPQEY
ARLPKLFFCEFCLKYTKSRAVLDRHMDKCQWRHPPATEIYRCDGLSVFEIDGNVNKIYCQ
NLCLLAKLFLDHKTLYYDVEPFLFYAVTKNDKYGCHLVGYFSKEKHCPAQRYNVSCIMTL
PQYQRQGFGRFLIHFPGEGNSKVAVVVDWSKVDAHMAKVRKSSRIKLDPDCLRWIPLLTQ
IPNPYQSPEESGDTSSESSPVMEPKHVPTIVEKIQKVKIKKKPRSRRLGQRRSSPLKQKT
GQKSSTQKDSFTKDAKEPKEIKATKEAKEAKEPNEAKEANKDTEKRNRNIVVATAVENIK
EQMVVEAKNVASTSSRNSRAMNVSKNTNLINSTKATSLSGSTMTTTTTTTTTTTTTTTTT
VATMTTATTTMSRRRIRTPKISRYDGESVITSTTPMRKRKHSEKLEIEEKEEKSEGSCRK
RTRESLREKERDKEREKEKEKTKERDKPKDKDSYSKDKEKNDITEIEKFSSKAMESIMSS
VVQKPTKKQCKVDDILLKVTSRQTKCLQTKQAKEKKQNNSEQNQCNGKDDTKDMLKTLPV
SRRGRAKVEKEALKMPQLKPTQSPQPIPQSHTPQPLPQSHTPQPLSQSHTPQSIPTQSPQ
PMRQSHTPQPLPPSHTPQPMQLSLTQQTQNQSMAHGQNQQQSQGQQQSAQQQSAHQQQQQ
SQTQSHSNKRASGSQTTHRSRSTQQSSRSHRTTPPTSHAQVSSQGHTTSHTSHTTSHTSH
TTVAHTTHVPPQYQQSSSMSVPPVPHPHPHSHTHAAHSHNMAVISQGNYMAVASQTFPTQ
NTYVIQHRSSRSGAPTPCTTATNFYIQTSAMPPHSHTPAPSLSASGNHQTTNSCSLAKLQ
QLTNGLEMIPPTPPPAMNLTPPPPIPHTMTPPQTSRQLPTPPQVPLGYAKNYYNVNTVPP
TTPGPPSRSTSRSSANANMASLAQPYPSESLYRQTLDPGSTCPQMQSAASRVSPNVALNT
NLMAQYGYRVAQPATGYMNQAAQLGGFMNQASQLPVGVVNVPAPYPQDPHQQNPAAVYTT
YHGYINGGLMQPLNSSMRPR
NT seq 6543 nt NT seq  +upstreamnt  +downstreamnt
atggacgaacccgagtccgctgacacgtggtcggcctggttcctggacgcaatccgaaaa
atacgcagccagaaacagaggccgagtgtcgagcggatatgtcacgcgattcgacaacac
cataattatcacgaggaggaaatcgctgaacacctggaagttgctgtaaaacgtggcgat
gtgctcaagatctttaataaaggacaatcctcgtacaaagatcctggtggcttacaatcg
aaaccgctcaaggttggcaaggcctccgatcttagtaaagtactgggtaaggctgttaga
gaattgggagaaagggagggatcaaccttgaagaacatcgaaaaatacatccgacaaagt
catacagttgaggaagaagcggaaggtgatttgagaacagcgcttagactatctgctaaa
agagcagtcgatcgaggacttgtgatacaggatggtagactttttcggcaaccggatagg
ccaccttatcttaagaaacatggagaaaacgctcatattgtgccaccggagccccctgta
aataagttgccagctccattaccgatatgcagagaatgtcttggcgcgacgatagccgga
aataataataatacaaaacgcaatgtttccgaaaaactgagcagatgtaatgtatgcggt
gcagctttacataattcttgcgcaccacctgaactttcgaatcttgttgaaagaggtata
acgtggtcttgcgacgactgttctccaacatgtgccggttgccagttagaacgggaatcg
cagaattatctagtgaaatgttccggttgcgtcaaatgttaccatcctacttgtctagat
ccagcaattgacaaaaagaataaaataccctggaaatgtcgacactgtcaaacaccgcat
ataccggtatcaaaagatgataataaaaagaataaaatacaacaggacacggcaaattcg
ctcgaagagacaccgaccaatgcaaggaagagacttagcaaattacgcgagagtagaaaa
tccacgatatcgagaaagagcctgacgatttcaactccggtgaagaaagctggcgcagga
gtgggacaggtggacagcagctcggacggtaatgcgggtgttgtctcccctcgtcaacca
cctttgatttcctctcccttaccacaaccccccaccccactcgcaggccagggtaggcta
cttgaagaaaaaaacgatcggatttccaaagagaagcaaaaattttttagactgagtgcg
tttaacgcggagcacaataaattgaagcgggtggggggcagtgaaaaattaaaatgttct
cagaacgttagtcctaggttaactcggggaaacgcgaaccaaaaacaacccatatccagt
aaaaaggtactgctaatgtctagcagtagcagcagcagcgacgcgaccgatactgattct
tccgacgacaccagtgattcgaccgacgatgacgatgaagaagaggagggagcagtcagg
gatggggtcagggaggggggagaagaggaagaggaggtggacggtaataactctagcgca
tccaacgattcgtccacctcggaagaagacaatgacgacgacgacgacgacaacgacgac
gacaacgacgacgacgatgacgatgaagacgacgacgatgacgatgacgatgtcgataac
gataatcagaaaaaatgttctgtcattattggaggtggtaacgatggcggtgacagtacc
attatcaatgcctctcctaaaccgagaggtccgttttcatgtgatttaaacgaagataaa
ccttggggttttgctgcggccgcagctaagctcaacatggaatcgccattttttagtaat
attaccaatacttttggtgcaccgttacctaaactcgatgtaaccagtacatcgacgttc
ggattaccggttatcaattcgtttgatgggaagaaaaaacagaaaagcaataggaatggt
agtgctatatcggagagttttaataacgtggacgtaaataaaattaaacctggcactggt
caattaaaaggtctattcgatggactaagtcactttttttcagtacctactaacagtaga
gtaagatccagtactttgacgcctaattatgcgcctgatagaagaaagcggcctaattcg
gatgatagtgataacaagagcagtaaagttttaaaaggaacgcaaattaataagaatgac
aatctatcgtctgatttaggcaaattaaaagaaaaaaagaagacggagacaaggaacgat
ataacgagaattcctcggcctggaatatttacaccttctgatgaaacgttgtttagttct
cttaatgaaaaaatgccaaaaatgacgccgtcgaatttggttaaaaccgcggttaatagt
aagaggcacgaatacgagagaagaaagttaatgaaagataatacgccattaataaaatgt
gcgacagatgcatctttaccgtcattcccatcaccgttattatcatcgtcctcgtcctcg
tcgtcctcgtcgtcgtcgtcatcgtcgtcgtcatcgtcgtcgtcatcgtcgatgtcgtcg
tcatcgtcattatcatcatcgtcgacatttccgttaccattaccgttaccattaccgtta
tcgttatcgtcacccttaccattatcgttaccgttaccgttaccatcatcattatcatcg
tcatcgtcatcgtcatcgtcatcgtcgtcgtcgtcgtcgtcgtcgtcctcgtcgtcgtcg
tcgtcgtcgtcgtcgtcatcctcgtcgtcgtcgtcgtcgtcgtcgtcgtcgtcatcgtcg
tcatcgccatcatcatcatcatcatcttcatcttcattattatcgtcatcatcatcaccg
ccatcagcattaccgttatcgtcgctttcgtcatcgtcatcgtcaatatcatcatcatca
tcatcatcgatgtcagctcttaggcccgatcaatcttcgcgaaagaaaaatattcttgtg
gaagtgaatcaaacacgccaccctgtgcccgctgtttcgaggtccggcctgagttctgat
tccgtgaaatcaaatcccagcctaaagtccaatccacgagcctgtactagcgccaccacc
accaacaccaccacgacaccccgcgcgacaccctgctccaccaggaaggaggaaccgatt
ctacctcaatctctaccgccgggtgtcacacaaaaggatgttgacctgtttaaagaagcc
cgggatagagcagctcgattaaccactgtgaacaataccgaggaaactgtgacagtgaat
ccaggaaacaatacgagcaatacgggaaatactgggaatggcattaggaatcccgcggcc
atagtttttggtcgatatgaagtagagacatggtattccagtccatttccccaagaatac
gcaagattacctaaattattcttctgtgaattctgtttaaaatatacaaaaagtcgggcc
gtacttgacaggcatatggataaatgccaatggaggcatccaccggctaccgaaatctac
agatgtgacggattatccgtttttgagatcgatggaaacgtgaataagatatattgtcaa
aatttgtgtctattagcaaaattattcttggatcataagacgctgtactacgatgtagaa
ccatttttattttacgcggtaacaaaaaacgataaatatggttgtcatttagttggttat
ttcagcaaagagaaacattgtcccgcgcaaaggtacaatgtgtcatgtatcatgacttta
ccgcaatatcaaagacaaggattcggaaggttcttgattcatttcccgggagagggaaat
tctaaagtagctgtggtagtcgattggagcaaagtggatgctcatatggcgaaagtacga
aagagttctcgtatcaaattagatcctgattgtcttagatggataccattgctcacgcaa
attcctaatccatatcaaagtccggaagaaagcggtgataccagttccgagtcctctccc
gtcatggaaccgaaacacgtaccaactatcgttgaaaaaattcaaaaagtaaagattaaa
aagaaaccgaggagtagaagattagggcaaagaagatcttcaccgctgaaacagaaaacg
ggccagaaatcttccacgcaaaaagattcttttaccaaagatgcgaaagaaccaaaagaa
ataaaagcaacgaaagaagcgaaggaagcaaaggaaccgaacgaagcgaaagaagcaaat
aaagatacggaaaaaaggaatcgaaatattgttgtcgccactgcggtagaaaatattaaa
gaacagatggtagtggaagcaaaaaatgttgcatcaacatcatcgaggaattctcgagca
atgaatgtttcaaaaaatacaaatttgataaattcgacgaaagcaacatccttgtcaggg
tcaacaatgacgacgacaacgacgactaccacaaccaccaccaccaccactaccaccaca
gtagcaacgatgactacagcaacgacaacgatgtcgagacggagaatcagaacaccgaaa
atatctcgttacgacggagaatcggtaataacgtcgacaacgcctatgcgaaaacgaaaa
cattccgagaaactagagatcgaagaaaaagaagaaaagtctgaaggcagctgtagaaaa
aggacgcgggaatctttgcgagagaaagagagagataaagaacgagaaaaggaaaaggag
aaaacgaaagaacgggataagccaaaggataaagatagttactcgaaagataaagaaaag
aacgatataaccgagatagaaaagttttcttcaaaagcgatggaatcgataatgtcatcg
gtagtacaaaaaccgacgaaaaagcaatgcaaagtcgatgatattttgttaaaagtgact
agccggcaaactaaatgcttacaaacgaagcaagcgaaagaaaagaaacagaacaattcg
gaacagaatcagtgtaatggaaaagacgacacaaaagatatgttgaaaactttaccagta
tcgagacggggaagagcaaaagtcgagaaagaagcattaaaaatgccgcaattgaaaccg
acgcaaagtccacaacctattccgcaaagtcacacgccgcaaccgttacctcaatcccat
accccgcaacctctttcgcaatctcatacaccgcaaagtataccgacgcaaagtcctcaa
ccgatgcgacaaagtcacacaccgcaacctttaccaccgtctcacacaccgcaaccgatg
caactatctttgactcaacaaacgcaaaatcaaagtatggcgcatggtcaaaaccagcaa
caatctcaaggacaacaacaatctgcacaacaacaatctgcacatcaacaacaacagcaa
tcacaaacgcaatctcatagtaacaaaagggctagtggttcacaaacgactcatagatct
agatctacacagcaaagtagccgatcccatcgaacgacacctcctacgtctcatgctcaa
gtctcttcgcaagggcacaccacctctcacacgagtcacacgacctcccacacgagccat
acgacggttgcacatacgacgcatgtacctccgcaatatcaacaatcctcgtcaatgagt
gtaccgcctgttcctcatccgcatcctcattctcacacgcatgctgctcactcacacaat
atggctgttatttctcaagggaattatatggctgttgcttctcaaacttttccaacgcaa
aatacatacgtgattcaacatcgaagtagcagatctggtgcaccgacgccatgtactaca
gcgacaaatttttatattcaaacaagcgcgatgccaccgcattcgcatacaccggcacct
tctctctcagcttctggaaatcatcaaacgacaaattcgtgcagtttagcaaaattacaa
caattgactaatggattggaaatgattcctcctacgcctcctccagcgatgaatttaacg
ccaccacctcctataccgcacactatgacaccaccgcaaacatcaagacaattaccgaca
ccgcctcaagtacctcttggttacgcaaaaaattattataatgtcaacacagtaccacct
actactccaggaccacccagtagatcaacctcaagatcatcggcaaatgcaaatatggcg
tctcttgcacaaccatacccaagcgaaagcttatatcgtcaaactctcgatcctggaagt
acatgtcctcaaatgcaaagcgccgctagtagagttagtcctaacgtggcattgaataca
aatcttatggcccaatacggttatcgagtagcacaacctgctaccggttacatgaatcaa
gcagctcaacttggaggtttcatgaatcaagccagtcaattgcctgttggagtcgttaat
gtacctgcaccgtaccctcaagatccgcatcaacaaaatccagcagcagtgtatacaacg
tatcacggttacataaatggaggtctcatgcaacctctgaatagttcgatgaggccacgt
tag

DBGET integrated database retrieval system