KEGG   Apis mellifera (honey bee): 724338Help
Entry
724338            CDS       T01057                                 

Gene name
GB10235
Definition
OTU domain-containing protein 5-A-like
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     724338 (GB10235)
Peptidases [BR:ame01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   724338 (GB10235)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG14
AA seq 579 aa AA seqDB search
MTILSKKKTNASKDRREGGSTSEVDVHGVQNEHNSGSITLPNSPYQVRAANGFAVDLHGV
QTDHGSGSIVLTGSSYETSVDRREDKHFEEGSGPSHGKRHRQRASPHSGCIGRNSRSKRE
RERDRGRERDRERERERERQATPPAASCSGLQATDGGVIANNRMAIVGATANIEHELANG
YNSGDEYTGRTGNNLTLAEWQERDRWFEKRMRKMGFIVKKMGEDGACLFRAVADQVYGDQ
EMHGVVRKHCMDYIASNQEFFSHFVAEDFSTYVDRKRQEYVHGNHIEMQAMSEMYNRSIQ
LYCYSTEPINIFHTMVESDNEPIRLSYQRGSHYNSIVDPYKATIGVGLGLPSYNPGAADR
QLISDAVRQSEELHIEQTMLEDKIKATDWEATNEAIEEQVARESYLQWLRDNEMRKARSA
SSSSTSTVTSAQHSHAHFHSHGGRGQQRSHTSSPTTTQTSQDNLRNSPKINDSVRYNKRS
PQHQSTQGSTMSHLASDFESKISQEPMPGSSKEAHTSPDISLFNRLPPEVFGLTDWEDSD
ILSQVLATSQQEYLDSLKQSRSSASSANDTNNILDSSNS
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgaccattctgtcgaagaagaagacgaacgcctcaaaagatagacgagaaggaggcagc
acttccgaagtcgatgttcacggagtgcaaaacgagcataactccggatccatcacacta
cctaatagtccatatcaggtacgtgcagcgaacggtttcgcggtcgatctacacggggtt
cagaccgatcatggatctggttctatcgttcttacaggaagctcgtatgagacaagtgta
gatcgtcgagaagataaacattttgaagaaggaagtggtcccagtcatggtaaacgccac
agacaacgagcaagtccacacagtggttgcattggaagaaattcacgttcaaaacgtgaa
agagaaagagacagaggtcgagaaagagatagagagagagaaagagaacgtgaaagacaa
gctacacctcctgctgcatcttgcagtggcttacaagctacagatggtggtgtcatagct
aataatcgaatggctattgttggagctactgcaaatatagaacatgaattagctaatggt
tataatagtggtgatgaatatactggcagaactgggaacaatttaactctagctgaatgg
caagagcgagataggtggtttgaaaaacgaatgcgaaagatgggatttattgttaaaaag
atgggtgaagatggagcatgtttatttagagctgttgctgatcaagtttatggtgatcaa
gaaatgcatggtgtagttcggaagcattgcatggattatattgcttccaatcaggaattt
ttttctcatttcgtagcggaagattttagcacatatgtagataggaaacgacaagaatat
gtacatggaaatcatatagagatgcaagcaatgtctgaaatgtataatcgtagcattcaa
ttatattgctacagtactgaaccaattaatattttccatacaatggttgaaagtgataat
gaaccgatacgattgtcttatcaacgtggtagtcattataatagtatagtagatccatat
aaagctacgattggtgttggtcttggtttaccatcatataatcctggagctgcagatcga
caacttatatcagatgcagttcgtcaaagtgaagaattgcatattgaacaaacaatgcta
gaagataaaataaaagcaactgactgggaagcaacaaatgaagccatagaagaacaagtt
gcaagagaaagttatttgcaatggttaagggataatgagatgcgaaaagctcgatcagct
agtagcagcagtacaagtacggtaacaagtgcgcaacacagtcacgcgcattttcactct
catggaggtcgtggtcaacaacgtagccacacttcttctccgaccacgactcaaactagc
caagataatttgcgtaattcaccaaaaataaatgattcggtaagatacaataaaagatcc
ccgcaacaccaatcaactcaaggatctactatgtctcatcttgcctcagattttgaatct
aaaatttctcaggaacccatgccaggtagtagtaaagaagctcatacttcaccggatatt
tcattattcaatcgtcttcctcctgaagtatttggcttaactgattgggaagacagtgat
atactttcacaagttttggctacatcacagcaagaatatttggacagcttgaaacaatca
cggagttctgcctcctctgcaaatgatactaataatatactagattccagtaatagttaa

DBGET integrated database retrieval system