KEGG   Apis mellifera (honey bee): 724480Help
Entry
724480            CDS       T01057                                 

Gene name
asparagine-synthetase, GB13219
Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ame  Apis mellifera (honey bee)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ame00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG6
AA seq 441 aa AA seqDB search
MCGIWALFGLNVSSLTNICSNFEKITHRGPEAFKLEFDYAIKNGYFGFHRLAIVDNLYGM
QPMRLHQYPHLFLLCNGEIYNYKKLGLEYGFTYTTQCDVEVIIHLYAHLGIENVTRMLDG
VFAFCLMDIKNKRILIGRDPYGIRPLFKLSSDDGQLAICSESKGLIEIIKLITSKLTLKP
FPPGHYEKYEILNDGRTKLLKSVNYYQPGDKPCFQAFVPYNDLINTDIHGNIRKLLSIAV
QKRLMSDREIGCLLSGGLDSSLIAALLVKHAKDANLSYKIKSFAIGMGDSPDIIAARQVA
EYIGTEHHEIIFFENDVIDILDKLIYQLETCDITTIRASIGMYLVSRYIKQNTATTVIFS
GEGADELAQGYIYFRDAPNPIEAHNESVRLLKDIYLYDGLRADRTTSAFSLELRVPFLDI
QFTNYYLSLDAASRQPQGMIL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatttgggctctttttggattaaatgtatcatccttaactaatatttgcagt
aattttgaaaaaattacacaccgtggtccagaagcatttaaacttgaatttgattatgca
attaagaatggttattttggatttcatagattagcaattgtggataatctgtatggtatg
caaccaatgagacttcatcaatatccacatttatttttattatgtaatggtgaaatttat
aactataaaaagcttggtctagaatatggatttacatataccactcaatgtgatgtcgag
gtgataattcatttatatgcacatcttggtattgaaaatgtgaccaggatgcttgatgga
gtttttgcattttgtttaatggatattaaaaataaaagaattcttataggtagagatcct
tatggtattaggccacttttcaaattaagttctgatgatggacaattagcaatttgttca
gaaagcaagggacttatagaaataattaaattaataacttcaaaattaacattaaaacca
tttccaccaggacattatgaaaaatatgaaattttaaatgatggtagaacaaaattatta
aaaagtgtaaactattatcaacctggagacaaaccttgttttcaagcttttgttccttat
aatgatttgattaatacagatatacatggaaatataagaaaattactttcaattgctgtt
cagaaaagattaatgtctgatagagaaattggttgtttattatcaggaggcttggattca
agtttaattgctgctttacttgtaaaacatgcaaaagatgcaaatttatcatataaaata
aaaagttttgcaattggtatgggagatagtccagatattattgcagctagacaggttgca
gaatatataggaactgaacatcatgaaataatcttttttgaaaatgatgtaattgatatt
ttagacaaacttatttatcaattagagacttgtgatattactacaattcgagcctctatt
ggtatgtatcttgtctcaagatatatcaaacagaatacagcaacaactgtgatatttagt
ggagaaggtgctgatgaattagcacaaggatacatttattttagagatgcaccaaatcca
atagaagctcataatgaatctgtacgattattaaaagatatatatttatatgatggtttg
agagcagatagaacaactagtgcatttagtttagaattacgagttccatttttagatatt
caattcacaaattattatttatcattggatgctgcttctagacaacctcaaggtatgata
ttataa

DBGET integrated database retrieval system