KEGG   Apis mellifera (honey bee): 724480Help
Entry
724480            CDS       T01057                                 

Gene name
asparagine-synthetase, GB13219
Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ame  Apis mellifera (honey bee)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    724480 (asparagine-synthetase)
Enzymes [BR:ame01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     724480 (asparagine-synthetase)
Peptidases [BR:ame01002]
 Cysteine Peptidases
  Family C44
   724480 (asparagine-synthetase)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG6
AA seq 441 aa AA seqDB search
MCGIWALFGLNVSSLTNICSNFEKITHRGPEAFKLEFDYAIKNGYFGFHRLAIVDNLYGM
QPMRLHQYPHLFLLCNGEIYNYKKLGLEYGFTYTTQCDVEVIIHLYAHLGIENVTRMLDG
VFAFCLMDIKNKRILIGRDPYGIRPLFKLSSDDGQLAICSESKGLIEIIKLITSKLTLKP
FPPGHYEKYEILNDGRTKLLKSVNYYQPGDKPCFQAFVPYNDLINTDIHGNIRKLLSIAV
QKRLMSDREIGCLLSGGLDSSLIAALLVKHAKDANLSYKIKSFAIGMGDSPDIIAARQVA
EYIGTEHHEIIFFENDVIDILDKLIYQLETCDITTIRASIGMYLVSRYIKQNTATTVIFS
GEGADELAQGYIYFRDAPNPIEAHNESVRLLKDIYLYDGLRADRTTSAFSLELRVPFLDI
QFTNYYLSLDAASRQPQGMIL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatttgggctctttttggattaaatgtatcatccttaactaatatttgcagt
aattttgaaaaaattacacaccgtggtccagaagcatttaaacttgaatttgattatgca
attaagaatggttattttggatttcatagattagcaattgtggataatctgtatggtatg
caaccaatgagacttcatcaatatccacatttatttttattatgtaatggtgaaatttat
aactataaaaagcttggtctagaatatggatttacatataccactcaatgtgatgtcgag
gtgataattcatttatatgcacatcttggtattgaaaatgtgaccaggatgcttgatgga
gtttttgcattttgtttaatggatattaaaaataaaagaattcttataggtagagatcct
tatggtattaggccacttttcaaattaagttctgatgatggacaattagcaatttgttca
gaaagcaagggacttatagaaataattaaattaataacttcaaaattaacattaaaacca
tttccaccaggacattatgaaaaatatgaaattttaaatgatggtagaacaaaattatta
aaaagtgtaaactattatcaacctggagacaaaccttgttttcaagcttttgttccttat
aatgatttgattaatacagatatacatggaaatataagaaaattactttcaattgctgtt
cagaaaagattaatgtctgatagagaaattggttgtttattatcaggaggcttggattca
agtttaattgctgctttacttgtaaaacatgcaaaagatgcaaatttatcatataaaata
aaaagttttgcaattggtatgggagatagtccagatattattgcagctagacaggttgca
gaatatataggaactgaacatcatgaaataatcttttttgaaaatgatgtaattgatatt
ttagacaaacttatttatcaattagagacttgtgatattactacaattcgagcctctatt
ggtatgtatcttgtctcaagatatatcaaacagaatacagcaacaactgtgatatttagt
ggagaaggtgctgatgaattagcacaaggatacatttattttagagatgcaccaaatcca
atagaagctcataatgaatctgtacgattattaaaagatatatatttatatgatggtttg
agagcagatagaacaactagtgcatttagtttagaattacgagttccatttttagatatt
caattcacaaattattatttatcattggatgctgcttctagacaacctcaaggtatgata
ttataa

DBGET integrated database retrieval system