KEGG   Apis mellifera (honey bee): 724510Help
Entry
724510            CDS       T01057                                 

Gene name
sws, GB10208
Definition
neuropathy target esterase sws
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
ame  Apis mellifera (honey bee)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    724510 (sws)
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     724510 (sws)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG3
AA seq 1340 aa AA seqDB search
MEVVELFNKCNESLGSYIFSRWIGKLITEYQTSKTLFSIIISSLVILLIISIIILRKWKN
KEFLPEVKEFVGVGTGKPRFRKRDKVLFYGRKMLRKVKSISGQVHATGQGKKRKAVMRFA
RRLLQLKKETVPQQLKVLEPPAEYLEEDLGPGEKVPPDALYMLQSIRVFGHFEKPVFLKL
CKHTEIMNLPAGSTLFKIGDPDENLFIVQQGLVNVYITGPDGSQISLKLVKTGESVTSLL
SFTDVLTGHTSTYKTVSARAVEDSIVVKLPMNAFQEVFQDHPDAFVRVIQVIMVRLQRVT
FTALHQYLGLSAELVNQGSHKKKQSPFSGSPVRSRTKENCSTQNIENQSNTFTTISSEHD
KNEIVHISTLSSHQSVPIVISRRQKTNLDWKNQNLSSQSGQNTADMVPECDSHWPNSSPI
TSQQGSQPDVIHTGNSHNKKRSITTEPIQQQLDEAHLVQIATEAFIRELGLEDDSILKDG
KVQIREVPSGTYLMKEESHKDVALVYVISGILIVSQRVSEGRDVGQEVHMFSAHQGEIVG
GLAVLTGEPSFYTIRAKHSSRIALLSKSTFFAIMREQPTVVLHVAHSVVRRLSPFVRQVD
FALDWLFLESGRAVYRQGDESDSTFIVLSGRLRSVITYKNGKKELVAEYGKGDLVGIVEM
VTQTPRSTTVMAVRDSELAKLPEGLFNVIKLRYPIVVTRLINLLGHRILGTWQQAHTKNG
SNDTQRAAATVDARPAQVNFSTVAIVPVSDDVPLTAFTYELYHSLCAIGPCLRLTSDVVR
KTLGSTIMEPANEYRLTSWLAQQEDQHRISLYQCDPTYTLWTQRCVRQADCILIVGLGDK
PPSIGRTEREVERLVMRTQKELVLLHKEQSGQRPTNTVQWLNMRSWVSSHHHIQCPKRMF
TRRSQYRINELYSKVLMSEPNIHSDFSRLARWLTGTSVGLVLGGGGARGAAHVGMLKAVI
EAGIPIDMVGGVSIGAFMGALWCMEKNITTTTQKAREWSKKMTQWWRQIMDLTYPVTSMF
SGKDFNNTIQATFGDTYIEDLWLPYFTLTTDITDSCMRTHTHGSLWRYIRASMSLSGYMP
PMCDPVDGHLLLDGGYVNNLPADEMLRQGAHHILAIDVGSQDDTDLTNYGDSLSGWWLLW
KRWNPFATPVKVPNLPDIQSRLAYVSCVRQLEEVKSSDYCEYIRPPIDKYKTLQFANFDE
IKDVGYQHGKTYFEGQLKAGVLPRFNADRENARALRAKHQAANQQSISSYTFTDLAQMVC
KVSRGSIYVDLEIDSDTDELEEYEADLEEDAQEVGYASEPTAGILDQSPDENRLRRRTGV
SLSLSDTEAESELDYHTKMF
NT seq 4023 nt NT seq  +upstreamnt  +downstreamnt
atggaggtagtagaattattcaataaatgtaatgaaagtttgggttcttatattttttca
agatggattggcaaattaattacagaataccaaacatcaaagaccctatttagtattata
atatcaagtcttgtgattttattaattatatctataatcattctgagaaaatggaaaaac
aaagaatttcttccagaagtaaaagaatttgttggagtaggtacaggcaagcccagattc
agaaaaagagacaaagtacttttttatggaagaaaaatgttacgcaaagtaaaatccatc
agtggacaagtacatgcaactggacaaggaaaaaaaagaaaagctgtaatgagatttgca
cgaagacttttgcaacttaaaaaagaaacagtaccacaacaattaaaagttttagaacca
cctgctgaatatttagaagaagatctaggtcctggagaaaaagtaccacctgatgcttta
tatatgttgcaaagtatcagagtatttggtcattttgaaaaaccagtatttcttaaatta
tgcaaacatacagaaattatgaatttaccagctggaagcaccttatttaaaattggagat
ccagatgaaaatttatttatagtacaacaaggcttagttaatgtttatattacaggacct
gatggttctcaaatatcattgaaattagtaaaaactggagaatcagtaactagtcttctt
agcttcacagatgtacttactgggcatacaagtacctataaaacagtatcagctagagct
gtagaagattctattgtagtaaaattaccaatgaatgcatttcaagaggtttttcaagat
catcctgatgcatttgttcgagttatccaggtcattatggtccgtcttcaaagagtcact
tttactgctctccatcaatatcttggattatctgcagaattagttaatcaaggatcacat
aaaaagaaacaaagtccattttctggatctccagttagatcaagaactaaagaaaattgt
tctacccagaatatagaaaatcaatccaatacatttacaactatttcatcagaacatgat
aaaaatgaaatagttcatatttctacattaagtagtcatcaaagtgtaccaattgttata
agtcgacggcaaaaaactaatcttgattggaaaaatcaaaatttaagttcacaatcaggt
caaaatacagcagatatggtaccagaatgtgattctcattggccaaattcttctcctata
acatcacaacaaggatcacaaccagatgtaatacatactggaaattcacataacaagaaa
agatcgattactactgaaccaattcaacaacaattagatgaagcacatcttgtgcaaata
gctacagaagcattcattagggaacttggattagaagatgattcaatactcaaagatggt
aaagttcaaattagagaagtaccaagtggtacatatttgatgaaggaagaatctcacaag
gatgttgcacttgtctatgttatatctggtatattaatagttagtcaacgcgtttcagaa
ggtagagatgtaggtcaagaagttcatatgtttagtgctcatcaaggcgaaattgtcggt
ggtttagctgtattaaccggagaaccttctttttataccattagagcaaaacattctagt
cgcatagcacttcttagtaaatcaacatttttcgctattatgcgagaacaaccaactgtt
gtattacatgttgcccattcagttgttcgaagactgagcccctttgtaagacaggttgat
tttgcacttgattggctatttcttgaaagtggaagagcagtatatcgacaaggagatgaa
tcagattcgacatttattgtattaagtggtcgacttcggtcggtaattacatataaaaat
gggaaaaaagaacttgttgcagaatatgggaaaggtgatcttgtaggtattgtagaaatg
gttacacaaacaccacgatcaacaacagtaatggcagtgcgagactctgaattagcaaaa
cttcctgaaggattatttaacgttataaaacttcgttatccaatagtagttacaagactt
ataaatttacttggacatcgtatacttggcacttggcaacaagcacatacaaaaaatggc
agtaacgatacacaacgagccgcagcgacagttgatgcaagaccagctcaagtaaatttt
tcaactgttgcaatagttccggtatccgatgatgttcctctaactgcatttacgtacgaa
ctttatcattcattatgtgctattgggccatgtctacgtcttacttctgatgttgttcga
aaaacattaggtagcactataatggaacctgcaaatgaatatcgtctaacatcatggctt
gcacaacaagaagatcaacatcgaatttcattatatcaatgtgatccaacatatacattg
tggactcaacgatgtgttcgacaagctgattgtattcttattgtgggtttaggagataag
cctccatctataggtagaactgaacgtgaagttgaacgtttagtaatgagaacacaaaaa
gaattagtactcttacataaagaacaaagcggacaacgacctacaaatacagtacagtgg
ttgaatatgagatcttgggtttctagtcatcatcacattcaatgccctaaacgaatgttt
acgagaagatctcagtacagaattaatgaattgtattctaaagttttgatgtctgaacca
aacatacatagtgatttcagtagacttgctcgttggttaactggaacttcagttggactt
gtacttggaggtggaggtgctagaggtgcagctcatgtaggaatgcttaaagctgttatt
gaagctggaatacctatagatatggttggaggagttagtattggagcatttatgggtgct
ttatggtgtatggaaaaaaatataacaacaacaacgcaaaaagctcgtgaatggtctaaa
aaaatgacacaatggtggagacaaataatggatttaacatatccagtaacatctatgttt
tctggaaaagattttaataatacaattcaagcaacatttggagatacatatatagaagat
ttatggttaccatattttacattaactacagacatcaccgattcttgtatgcgtacgcat
acacacggatcgctgtggcggtacattcgggcttcgatgtctttgtctggttatatgcca
cccatgtgtgacccagttgacggccatctcctgctcgacggcgggtacgtcaataacctt
ccagctgacgaaatgttgaggcaaggagcacatcatattttggctattgatgttgggtca
caagatgacacggatttaacgaattatggagattctttatctggttggtggttattatgg
aaacgatggaatccatttgcaacgcctgtcaaagttccgaatttacccgacatacaatcg
cgattggcatatgttagttgtgtacggcaattagaagaagttaaaagctcagattactgt
gaatacatcaggccaccaatagataaatataaaactctccaattcgctaactttgatgaa
attaaagatgttggatatcaacatggaaaaacttatttcgaaggacaattaaaagctgga
gttttaccacgttttaatgctgatagagaaaatgcccgcgcattacgagcaaaacatcaa
gcagcaaatcagcaatcaatatcttcatatacttttacagatttagctcaaatggtgtgt
aaagtctctagaggaagtatatatgtagatttggaaattgattctgacacggatgaatta
gaagaatacgaggcagatttggaagaagatgcacaagaagtaggttatgcctctgaaccc
actgccggtattctagatcagagtcctgatgaaaatcgtttacgacgaagaactggtgtt
tctttaagtttatctgacacagaagcagaatcagagttagattatcataccaaaatgttc
taa

DBGET integrated database retrieval system