KEGG   Apis mellifera (honey bee): 724510Help
Entry
724510            CDS       T01057                                 

Gene name
sws, GB10208
Definition
neuropathy target esterase sws
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
ame  Apis mellifera (honey bee)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ame00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG3
AA seq 1340 aa AA seqDB search
MEVVELFNKCNESLGSYIFSRWIGKLITEYQTSKTLFSIIISSLVILLIISIIILRKWKN
KEFLPEVKEFVGVGTGKPRFRKRDKVLFYGRKMLRKVKSISGQVHATGQGKKRKAVMRFA
RRLLQLKKETVPQQLKVLEPPAEYLEEDLGPGEKVPPDALYMLQSIRVFGHFEKPVFLKL
CKHTEIMNLPAGSTLFKIGDPDENLFIVQQGLVNVYITGPDGSQISLKLVKTGESVTSLL
SFTDVLTGHTSTYKTVSARAVEDSIVVKLPMNAFQEVFQDHPDAFVRVIQVIMVRLQRVT
FTALHQYLGLSAELVNQGSHKKKQSPFSGSPVRSRTKENCSTQNIENQSNTFTTISSEHD
KNEIVHISTLSSHQSVPIVISRRQKTNLDWKNQNLSSQSGQNTADMVPECDSHWPNSSPI
TSQQGSQPDVIHTGNSHNKKRSITTEPIQQQLDEAHLVQIATEAFIRELGLEDDSILKDG
KVQIREVPSGTYLMKEESHKDVALVYVISGILIVSQRVSEGRDVGQEVHMFSAHQGEIVG
GLAVLTGEPSFYTIRAKHSSRIALLSKSTFFAIMREQPTVVLHVAHSVVRRLSPFVRQVD
FALDWLFLESGRAVYRQGDESDSTFIVLSGRLRSVITYKNGKKELVAEYGKGDLVGIVEM
VTQTPRSTTVMAVRDSELAKLPEGLFNVIKLRYPIVVTRLINLLGHRILGTWQQAHTKNG
SNDTQRAAATVDARPAQVNFSTVAIVPVSDDVPLTAFTYELYHSLCAIGPCLRLTSDVVR
KTLGSTIMEPANEYRLTSWLAQQEDQHRISLYQCDPTYTLWTQRCVRQADCILIVGLGDK
PPSIGRTEREVERLVMRTQKELVLLHKEQSGQRPTNTVQWLNMRSWVSSHHHIQCPKRMF
TRRSQYRINELYSKVLMSEPNIHSDFSRLARWLTGTSVGLVLGGGGARGAAHVGMLKAVI
EAGIPIDMVGGVSIGAFMGALWCMEKNITTTTQKAREWSKKMTQWWRQIMDLTYPVTSMF
SGKDFNNTIQATFGDTYIEDLWLPYFTLTTDITDSCMRTHTHGSLWRYIRASMSLSGYMP
PMCDPVDGHLLLDGGYVNNLPADEMLRQGAHHILAIDVGSQDDTDLTNYGDSLSGWWLLW
KRWNPFATPVKVPNLPDIQSRLAYVSCVRQLEEVKSSDYCEYIRPPIDKYKTLQFANFDE
IKDVGYQHGKTYFEGQLKAGVLPRFNADRENARALRAKHQAANQQSISSYTFTDLAQMVC
KVSRGSIYVDLEIDSDTDELEEYEADLEEDAQEVGYASEPTAGILDQSPDENRLRRRTGV
SLSLSDTEAESELDYHTKMF
NT seq 4023 nt NT seq  +upstreamnt  +downstreamnt
atggaggtagtagaattattcaataaatgtaatgaaagtttgggttcttatattttttca
agatggattggcaaattaattacagaataccaaacatcaaagaccctatttagtattata
atatcaagtcttgtgattttattaattatatctataatcattctgagaaaatggaaaaac
aaagaatttcttccagaagtaaaagaatttgttggagtaggtacaggcaagcccagattc
agaaaaagagacaaagtacttttttatggaagaaaaatgttacgcaaagtaaaatccatc
agtggacaagtacatgcaactggacaaggaaaaaaaagaaaagctgtaatgagatttgca
cgaagacttttgcaacttaaaaaagaaacagtaccacaacaattaaaagttttagaacca
cctgctgaatatttagaagaagatctaggtcctggagaaaaagtaccacctgatgcttta
tatatgttgcaaagtatcagagtatttggtcattttgaaaaaccagtatttcttaaatta
tgcaaacatacagaaattatgaatttaccagctggaagcaccttatttaaaattggagat
ccagatgaaaatttatttatagtacaacaaggcttagttaatgtttatattacaggacct
gatggttctcaaatatcattgaaattagtaaaaactggagaatcagtaactagtcttctt
agcttcacagatgtacttactgggcatacaagtacctataaaacagtatcagctagagct
gtagaagattctattgtagtaaaattaccaatgaatgcatttcaagaggtttttcaagat
catcctgatgcatttgttcgagttatccaggtcattatggtccgtcttcaaagagtcact
tttactgctctccatcaatatcttggattatctgcagaattagttaatcaaggatcacat
aaaaagaaacaaagtccattttctggatctccagttagatcaagaactaaagaaaattgt
tctacccagaatatagaaaatcaatccaatacatttacaactatttcatcagaacatgat
aaaaatgaaatagttcatatttctacattaagtagtcatcaaagtgtaccaattgttata
agtcgacggcaaaaaactaatcttgattggaaaaatcaaaatttaagttcacaatcaggt
caaaatacagcagatatggtaccagaatgtgattctcattggccaaattcttctcctata
acatcacaacaaggatcacaaccagatgtaatacatactggaaattcacataacaagaaa
agatcgattactactgaaccaattcaacaacaattagatgaagcacatcttgtgcaaata
gctacagaagcattcattagggaacttggattagaagatgattcaatactcaaagatggt
aaagttcaaattagagaagtaccaagtggtacatatttgatgaaggaagaatctcacaag
gatgttgcacttgtctatgttatatctggtatattaatagttagtcaacgcgtttcagaa
ggtagagatgtaggtcaagaagttcatatgtttagtgctcatcaaggcgaaattgtcggt
ggtttagctgtattaaccggagaaccttctttttataccattagagcaaaacattctagt
cgcatagcacttcttagtaaatcaacatttttcgctattatgcgagaacaaccaactgtt
gtattacatgttgcccattcagttgttcgaagactgagcccctttgtaagacaggttgat
tttgcacttgattggctatttcttgaaagtggaagagcagtatatcgacaaggagatgaa
tcagattcgacatttattgtattaagtggtcgacttcggtcggtaattacatataaaaat
gggaaaaaagaacttgttgcagaatatgggaaaggtgatcttgtaggtattgtagaaatg
gttacacaaacaccacgatcaacaacagtaatggcagtgcgagactctgaattagcaaaa
cttcctgaaggattatttaacgttataaaacttcgttatccaatagtagttacaagactt
ataaatttacttggacatcgtatacttggcacttggcaacaagcacatacaaaaaatggc
agtaacgatacacaacgagccgcagcgacagttgatgcaagaccagctcaagtaaatttt
tcaactgttgcaatagttccggtatccgatgatgttcctctaactgcatttacgtacgaa
ctttatcattcattatgtgctattgggccatgtctacgtcttacttctgatgttgttcga
aaaacattaggtagcactataatggaacctgcaaatgaatatcgtctaacatcatggctt
gcacaacaagaagatcaacatcgaatttcattatatcaatgtgatccaacatatacattg
tggactcaacgatgtgttcgacaagctgattgtattcttattgtgggtttaggagataag
cctccatctataggtagaactgaacgtgaagttgaacgtttagtaatgagaacacaaaaa
gaattagtactcttacataaagaacaaagcggacaacgacctacaaatacagtacagtgg
ttgaatatgagatcttgggtttctagtcatcatcacattcaatgccctaaacgaatgttt
acgagaagatctcagtacagaattaatgaattgtattctaaagttttgatgtctgaacca
aacatacatagtgatttcagtagacttgctcgttggttaactggaacttcagttggactt
gtacttggaggtggaggtgctagaggtgcagctcatgtaggaatgcttaaagctgttatt
gaagctggaatacctatagatatggttggaggagttagtattggagcatttatgggtgct
ttatggtgtatggaaaaaaatataacaacaacaacgcaaaaagctcgtgaatggtctaaa
aaaatgacacaatggtggagacaaataatggatttaacatatccagtaacatctatgttt
tctggaaaagattttaataatacaattcaagcaacatttggagatacatatatagaagat
ttatggttaccatattttacattaactacagacatcaccgattcttgtatgcgtacgcat
acacacggatcgctgtggcggtacattcgggcttcgatgtctttgtctggttatatgcca
cccatgtgtgacccagttgacggccatctcctgctcgacggcgggtacgtcaataacctt
ccagctgacgaaatgttgaggcaaggagcacatcatattttggctattgatgttgggtca
caagatgacacggatttaacgaattatggagattctttatctggttggtggttattatgg
aaacgatggaatccatttgcaacgcctgtcaaagttccgaatttacccgacatacaatcg
cgattggcatatgttagttgtgtacggcaattagaagaagttaaaagctcagattactgt
gaatacatcaggccaccaatagataaatataaaactctccaattcgctaactttgatgaa
attaaagatgttggatatcaacatggaaaaacttatttcgaaggacaattaaaagctgga
gttttaccacgttttaatgctgatagagaaaatgcccgcgcattacgagcaaaacatcaa
gcagcaaatcagcaatcaatatcttcatatacttttacagatttagctcaaatggtgtgt
aaagtctctagaggaagtatatatgtagatttggaaattgattctgacacggatgaatta
gaagaatacgaggcagatttggaagaagatgcacaagaagtaggttatgcctctgaaccc
actgccggtattctagatcagagtcctgatgaaaatcgtttacgacgaagaactggtgtt
tctttaagtttatctgacacagaagcagaatcagagttagattatcataccaaaatgttc
taa

DBGET integrated database retrieval system