KEGG   Apis mellifera (honey bee): 724537Help
Entry
724537            CDS       T01057                                 

Gene name
GB19625
Definition
ubiquitin carboxyl-terminal hydrolase 36-like
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     724537 (GB19625)
Peptidases [BR:ame01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   724537 (GB19625)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG1
AA seq 884 aa AA seqDB search
MPAVSICDPVAATLRRTLDTNQSKTSDELSTNLVTSASRILQSEIQYKEVDDYQTTILDQ
LKAKYIVLSLPNSESLDEKIKDGVNYTKKNERGCKGPSLPEPTITLYSPKKVSLGWKGTF
PVGAGMYNVGNTCYLNSTLQALFHVPALVNWLLSDSHHTSKCEQNDGGGECLTCAVAKTL
QFSHQKSGCAIKPFYIYNKLKLICRTMVPGQQEDAHEFLRYLLEGMEKAYLARHKASKLD
SYSKETTPINQIFGGYIRTEVKCLQCRHVSTTFQHFQDLLVDIRKASTLDEALSSYFSRE
QLDNNDYKCEACKRRVPATKQFSLERPPKVLCVQLKRFSVLGGKISKHIGFKQTIDMGPY
LWKEPGESSQSLTYKLMSIVTHMGPSVNCGHYTAVAKVSTGQYYSFDDSCVRPLSLSNVL
STNAYIMIFEMEQQTQSQIQAQQTLKLNGTMTVNNTLSSSGSSMNKNIAPKASTSGLLSL
NGLINGTSANKDTTENLESSMQISINNNSGLQFTTQKNTSFIGPQLPQKLQDKSQPRLIM
LIKNGKILNGNSLVPYDGSSEEEDINSIGTLKNHTNSNTSVKKNISVSTTNGTQKCSLVK
SSSPTAKIVLNSKEVQKCTSKTNGSNAQNQTNITQCTKTQNGSSCSTITSTIKYQNGKSE
ANGKTESGSNNSKSKWHQSVRVKTGQDDKVITKATSSSIKGWQVSKDTSFSPTSTAAPNG
WSVTDKEDVHKINQNNNTPSAAALRNFNGTNRSDTVSHLLKMSHRGYGSSSVINWNGNRT
HLDREVDNDRREERKRHFNADDEEIDRGRVKKVKDHRTYEERSNTGYNPFQEYQNGKTWN
RSLGGYYRRHYYNTSNNARPRHGRNYRPSYYRYHNHSRAHWQRG
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctgtaagcatttgtgacccagttgcggctacacttcgtcgtactttagacact
aaccagtccaaaacatcagatgagttgtcaacaaatttagttaccagtgcatcaagaatt
cttcagtcagaaattcaatataaagaagtggatgattatcaaactacgattttagatcaa
cttaaagccaaatacattgtattaagtttaccaaattccgaaagtttagatgaaaaaata
aaagatggagtaaattatacaaaaaagaatgaaagaggatgtaaaggacccagtttgcca
gaaccaactattaccttatattctccaaagaaagttagcttaggatggaagggtacgttt
ccagttggagctggcatgtataatgttggaaatacatgctatttaaatagcactctccaa
gctttgtttcatgtaccagctcttgttaattggttattatcagattctcatcatacatca
aaatgtgaacaaaatgatggaggtggagaatgccttacatgtgcagtggctaagacttta
caatttagtcatcagaaatcaggatgtgccattaagccattctacatatataataaatta
aaacttatttgtcgaaccatggtaccaggacagcaagaagatgctcatgaatttttacgt
tacttattagaaggcatggaaaaagcttatttagcaagacacaaagctagtaaactagac
agttattctaaagaaacaacacctattaatcaaatttttggtggttatattcgtactgaa
gtgaaatgtttacagtgtcggcatgtttctacaacttttcaacattttcaagatttattg
gttgatatacgtaaagcaagtactctggatgaagcattaagtagttattttagtcgtgaa
caactagataacaatgattataaatgtgaagcttgcaaaagaagagttcctgctacaaaa
caatttagcttagaaagacctcctaaagtactttgcgtacaattaaaaagattcagtgtt
ctaggaggaaaaatatctaaacatataggtttcaagcaaactatagatatgggtccttat
ctttggaaagaaccaggagaatcatcacaatcacttacatataaacttatgtcaatagtt
acacatatgggtccatcagttaattgtggacattatactgcagttgctaaagtttcgaca
ggccaatattattcctttgatgattcttgtgttcgtccacttagtttgagtaatgtactc
agtacaaatgcttatataatgatctttgaaatggaacaacaaacacaatctcaaattcaa
gcacaacaaactcttaaattaaatggtacaatgactgtgaataacacattatcttcatca
ggaagttctatgaataaaaatatagctcccaaagcatcaacatctggcttactctcatta
aatggattaattaatggtacatcagccaataaagatactacggaaaatttggaatcaagc
atgcagatatcgataaataataattcaggacttcagtttactactcaaaaaaatacaagt
tttattgggccgcaattaccacaaaaattacaagataaatctcaaccaagattgattatg
ttgattaaaaatggaaagattttaaatgggaatagtttagtaccttatgatggatctagc
gaagaagaagatattaattctattggaacattaaaaaatcatacaaattcaaatacttca
gtaaaaaaaaacatttctgttagtaccactaatggtacacaaaaatgttctttagtgaaa
agtagttcacctactgctaaaatagttcttaattcaaaagaagtacaaaaatgtacatct
aagacaaacggcagtaatgctcagaatcaaacaaatataacacaatgtacaaaaacacaa
aatggttctagctgtagtaccattacaagtacaataaaatatcaaaatggtaaatcagaa
gcaaatggtaaaacagaaagtggtagtaataatagcaaaagtaagtggcatcaatcagtt
agagtaaaaacaggacaagacgacaaagtgattacaaaggctacaagcagcagtataaaa
ggttggcaagtttcaaaagatacatcattctcacctacatcaactgcagcaccaaatgga
tggtccgtgactgataaagaagatgttcataaaattaatcagaataataacacgcccagt
gctgcagctttaagaaactttaatgggacaaatcgttccgatactgtttctcatttatta
aagatgtctcatcgtggttatggcagttcttcggttataaattggaacggcaacagaaca
cacttagatagagaagttgataatgatagaagagaagaacgtaaacgacatttcaatgca
gatgatgaagaaatagatcgtggtcgagtaaagaaagtaaaagatcatcgaacatatgaa
gaaagaagtaatacaggatataatcctttccaagaatatcaaaatggcaaaacgtggaat
cgatctctcggtggttattatcggagacattattataatacttccaataatgcacgaccg
cgacatggtagaaattataggccttcatattacagatatcataatcattctcgtgcacat
tggcagcgaggataa

DBGET integrated database retrieval system