KEGG   Apis mellifera (honey bee): 724646Help
Entry
724646            CDS       T01057                                 

Definition
uncharacterized LOC724646
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     724646
Transcription machinery [BR:ame03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     724646
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG14
AA seq 701 aa AA seqDB search
MEIEEIYSLTIFPPVISKFAVQWSMDNNISILTEKGIHIFELIPSPISPSSTIKFSRSFI
YTPSTFPTEIISNRIESKIWNMHREELYSFIIEESMTPKLSNVKEMVPKIIDLAWSPKDL
IHPSKCLIAILTSAGAVIIACKICRDWYPVYDLSSLRYSIIEQEINEELEENKNNSASFE
TFKIYMKALQASCFTWSKFFADFAYFVVAYLNGDIIIYKILKVFDYNEILNPKIVGIIRL
NESVKMNVLNWITINTKKHLIIIGYFDGRIHGLNIEEHDGNFELMFIEKYYDYTDRIAIS
AIKIFPQSDLNINVLIAKGYYLFLLCFKENGTLRSMQHLQLEGFMISGMICISTNCALIT
TENGSMFAIDIKENQLLKTKVNNKLSQVHVRCLGLAHSPSSVIFINITSPSTMYDHLVIK
EPTKIYMFCLKNKNWNPLFILNQSKHEKFEQLWDCLEAIRIKATKVSDLSLILPKIPSNL
EFLSLHELRIVMWTSVIMEICEKRKIIQGMNNIAGEISEAQPLIFIHTACNYLIHLESKS
SLIEHQKISMNLLRMYLEVYLAGEENKKVTPLSKRIRDVLKKISQFNLNNIETCNLCGEM
INDLSWKISKCSQGHILPRCAITLLQVTVVPYKTCPICGLIFHPCLDQEFKETRCPFCDV
PALEENRMLNSKYYIPKEKSLSRLHNYILEDQEMEIVTEES
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atggagatagaagaaatttatagccttacaatttttccaccagtaatatccaaattcgca
gttcaatggtctatggataataatatttctattcttactgaaaaaggaattcatatattc
gaattgataccttctccaatatctccttcttcaactataaaattctctagatcttttatt
tatacaccttcaacatttccaacagaaattatatctaacagaatagaatccaaaatttgg
aatatgcatcgtgaagaactttattcatttataattgaggaaagtatgactccaaaatta
tctaatgtaaaagaaatggtaccaaaaataattgatttagcatggtcaccaaaagattta
atacatccaagcaagtgtcttattgctattttaacttcagcaggtgctgttataattgca
tgtaaaatttgtagagattggtatcctgtatatgatttatcttctctacgttatagtatt
atagaacaagaaattaatgaagaattagaagaaaataaaaataactcagcttcatttgaa
acattcaaaatctacatgaaagcattacaagcttcttgtttcacttggagcaaatttttt
gcagattttgcatattttgttgttgcatatcttaatggagatataattatttataagatc
ctaaaggtatttgattataatgaaatacttaatcctaaaattgtaggaataataagatta
aatgaatctgtaaaaatgaatgttttaaattggattacaattaatacaaagaaacattta
attattattggatattttgatggacgtattcatggacttaatattgaagagcatgatgga
aattttgaactaatgttcattgaaaaatattatgattatactgatcgtattgctattagt
gctataaaaatatttcctcaaagtgatttaaatataaatgttcttattgcaaaaggatat
tatttatttttattatgctttaaagaaaatggtacattaagaagtatgcaacatttacaa
ttagaaggttttatgatttcaggaatgatttgtataagtacaaactgtgcattgatcaca
acagaaaacggttctatgtttgcaattgatataaaagaaaatcagttattaaaaacaaaa
gtaaataataaattatcacaagttcatgttcgatgtctaggtcttgcacattctccaagt
tctgtaatttttataaatataactagtcctagcactatgtacgatcatttagtaataaag
gaaccaaccaaaatatatatgttttgtttaaagaataaaaattggaatccattatttatt
ttgaatcaaagtaaacatgaaaaatttgagcaattgtgggattgtttagaagcgattaga
ataaaagcaacaaaagtatcagacttatcattaatattaccaaaaattccatctaatttg
gaatttttatctttgcatgaattacgaatagtaatgtggacatctgtgataatggaaatt
tgtgaaaagaggaaaatcattcaaggaatgaataatattgctggagaaatatcagaagct
caacctttaatttttattcatactgcatgcaattatcttatacatcttgaaagtaaatct
tctctaatagaacaccaaaaaatttccatgaatttattaagaatgtatttagaagtatat
ttggctggagaagaaaataagaaagtaactccactttccaagcgtattagagatgtttta
aaaaaaatatctcaattcaatttaaataatatcgagacttgcaatctatgtggtgaaatg
ataaatgatctttcctggaaaattagtaaatgttcacaaggtcatatattacctagatgt
gctattactcttttacaagtaactgtagtgccatacaaaacatgtccaatatgtggttta
atttttcatccatgtttggatcaagaatttaaagaaacgagatgtcctttttgtgatgta
cctgcacttgaagaaaaccgaatgttgaattctaaatattatattccaaaggaaaaaagt
ttgtctagattacataattatatcctagaagatcaagaaatggaaatagttactgaggaa
tcttaa

DBGET integrated database retrieval system