KEGG   Apis mellifera (honey bee): 724724Help
Entry
724724            CDS       T01057                                 

Gene name
Pfk, GB17113
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ame  Apis mellifera (honey bee)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    724724 (Pfk)
   01230 Biosynthesis of amino acids
    724724 (Pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    724724 (Pfk)
   00030 Pentose phosphate pathway
    724724 (Pfk)
   00051 Fructose and mannose metabolism
    724724 (Pfk)
   00052 Galactose metabolism
    724724 (Pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    724724 (Pfk)
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     724724 (Pfk)
Protein phosphatases and associated proteins [BR:ame01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     724724 (Pfk)
Messenger RNA biogenesis [BR:ame03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     724724 (Pfk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG10
AA seq 773 aa AA seqDB search
MNAAVRAVVRMGIYLGCKVFFIKEGYQGMVDGGKNIQEATWSSVSSIIHKGGTIIGSARC
HDFEDHAGRKKAAKNLVKLGISNLVVIGGDGSLTGANLFKEEWSTLLKELAEEGEITIDQ
VEKYEHLHIAGLVGSIDNDFCGTDMTIGTDSALHRIIESIDAIVSTAYSHQRTFIMEVMG
RHCGYLALVAAICSEADFVFIPEWPPEQDWPNKLCKKLLQERLMGQRLNIIIVAEGALDR
NGEPITAEXIHKVVREKLQQDTRITVLGHVQRGGNPSAFDRVLGCRMGAEAVMALMEAKP
DTEACVVTLNGNQAVRLPLMECVRRTKGVAKAMADKNWNLAVQLRGKGFARNLETYKMLT
RLKAPIECTNPNKESNSPTLTKQFTLYGQSCHYTLGVIHIGSPSCGMNAAVRSFVRNCIY
RGDKVYGICDGILGLITGKFKLLDWPFVTGWVSQGGALLGTKRAPPKEDQLTQIAQRLKE
YEIQALLIVGGFEGYQTGLTFINARDKFEEFRIPIAMIPATISNNVPGTEFSLGCDTALN
EITEICDRIRQSAQGTKRRVFIIETMGGYCGYLATLAGLAGGADAAYIFEEKFNIKDLNQ
DVIAMAAKMSEGVQRGLILRNENANLNYSTDFMQRLFSEEGKGLFSCRMNIIGHMQQGGS
PTPFDRNLGTKMGSKAVEWFSEQLKKNTDANGKVTAMDADSAVMIGIVRQHYKFTPFAEL
LEMTDFEHRIPTYQWWMKLRPLLKVLAKHESTYEEEGLYITVEEMDVDNDSLV
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcagcagttcgagcagttgttagaatgggtatttatcttggatgtaaagttttc
tttattaaagaaggctatcagggtatggtagatggtggaaaaaatattcaagaagctact
tggtcatccgtttcttctatcatacataaaggtggtacaataataggatctgctcgatgt
catgactttgaagatcacgctggtcgcaaaaaagctgcaaaaaatttagtaaaacttgga
ataagtaatttagttgtaataggtggtgatggttcacttactggtgcaaatctatttaag
gaagaatggtcaaccttattaaaagaattagctgaagaaggagaaattacaatagaccaa
gtagaaaaatatgaacatttacacattgctggcttagtgggatctattgataatgatttt
tgcggaactgacatgactatcggtactgattctgcgttacatcgtattatcgaaagtatc
gatgctattgttagtacagcatattcccatcaaagaacattcataatggaagttatgggt
cggcattgcggttacctggccctagtggcagccatatgttctgaagctgattttgtgttc
atcccagagtggccacctgaacaagattggcccaataagctgtgcaaaaaattattacag
gaaagacttatgggacaacgacttaatattataattgtagctgaaggtgcattagataga
aatggtgaaccaattactgctgaanaaattcataaagttgttcgagaaaagctacaacaa
gatacaagaattactgttcttggtcatgttcaaagaggtggtaatccatctgcttttgat
agagttttgggctgtcgaatgggagcagaagcagtaatggcattaatggaagcaaaacca
gatactgaagcatgtgttgttacattaaatggcaatcaagctgtaagattacctcttatg
gaatgtgttcgacgtactaagggagtagcaaaagctatggccgataaaaattggaatctt
gcagttcaacttcgtggaaagggatttgctcgtaatttggaaacatataaaatgttgacc
cgtctgaaagcacctatagaatgtaccaatcccaataaggaaagtaacagtcccacatta
acaaagcaattcactttgtatggacaaagttgccattatacattaggtgtaatacatatt
ggttcaccttcttgtggtatgaatgccgctgtgcgttcttttgttagaaattgtatttat
cgaggagataaggtttatggtatttgtgacggaatcttgggtcttataactggaaaattt
aaattattggattggccttttgtcactggttgggtatcacaaggtggtgctcttttagga
actaaacgtgctccaccaaaagaggatcagttaacacagattgctcagagacttaaagaa
tatgaaattcaagctctacttattgtaggaggatttgagggttatcaaacaggacttact
tttattaatgctagagataaatttgaagaatttcgaattcctattgcaatgattccggca
actattagcaataatgttccaggaactgaattttcattaggatgtgatactgctttaaat
gaaattacggagatctgtgatcgaatccgtcagtctgcacaaggtacaaagcgtcgagta
tttattattgaaactatgggtggatattgtggttatttagctactttggctggattagct
ggtggagctgatgcagcatatattttcgaggaaaagtttaatattaaagatttaaatcaa
gatgttattgcaatggctgctaaaatgtctgaaggtgtacagagaggtcttattttaaga
aatgaaaatgcaaatttaaattatagtacagattttatgcaaagactttttagtgaagaa
ggaaaaggcctctttagctgtagaatgaatattattggtcatatgcagcaaggaggttca
ccaactccatttgatcgaaatttgggcacaaaaatgggttctaaagcagttgaatggttt
agtgaacaactaaaaaaaaatactgatgctaatggtaaagtaacagcaatggatgctgat
agtgcagttatgattggtattgtgcgacaacattataaatttacaccattcgcagaactt
cttgaaatgacggattttgaacatcgcattccaacatatcaatggtggatgaaattacga
ccattacttaaagttttagcaaaacacgagtctacatatgaggaagaaggtctttatatc
actgtagaagaaatggatgttgataatgattctcttgtataa

DBGET integrated database retrieval system