KEGG   Apis mellifera (honey bee): 724724Help
Entry
724724            CDS       T01057                                 

Gene name
Pfk, GB17113
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ame  Apis mellifera (honey bee)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    724724 (Pfk)
   01230 Biosynthesis of amino acids
    724724 (Pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    724724 (Pfk)
   00030 Pentose phosphate pathway
    724724 (Pfk)
   00051 Fructose and mannose metabolism
    724724 (Pfk)
   00052 Galactose metabolism
    724724 (Pfk)
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     724724 (Pfk)
Protein phosphatases and associated proteins [BR:ame01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     724724 (Pfk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG10
AA seq 773 aa AA seqDB search
MNAAVRAVVRMGIYLGCKVFFIKEGYQGMVDGGKNIQEATWSSVSSIIHKGGTIIGSARC
HDFEDHAGRKKAAKNLVKLGISNLVVIGGDGSLTGANLFKEEWSTLLKELAEEGEITIDQ
VEKYEHLHIAGLVGSIDNDFCGTDMTIGTDSALHRIIESIDAIVSTAYSHQRTFIMEVMG
RHCGYLALVAAICSEADFVFIPEWPPEQDWPNKLCKKLLQERLMGQRLNIIIVAEGALDR
NGEPITAEXIHKVVREKLQQDTRITVLGHVQRGGNPSAFDRVLGCRMGAEAVMALMEAKP
DTEACVVTLNGNQAVRLPLMECVRRTKGVAKAMADKNWNLAVQLRGKGFARNLETYKMLT
RLKAPIECTNPNKESNSPTLTKQFTLYGQSCHYTLGVIHIGSPSCGMNAAVRSFVRNCIY
RGDKVYGICDGILGLITGKFKLLDWPFVTGWVSQGGALLGTKRAPPKEDQLTQIAQRLKE
YEIQALLIVGGFEGYQTGLTFINARDKFEEFRIPIAMIPATISNNVPGTEFSLGCDTALN
EITEICDRIRQSAQGTKRRVFIIETMGGYCGYLATLAGLAGGADAAYIFEEKFNIKDLNQ
DVIAMAAKMSEGVQRGLILRNENANLNYSTDFMQRLFSEEGKGLFSCRMNIIGHMQQGGS
PTPFDRNLGTKMGSKAVEWFSEQLKKNTDANGKVTAMDADSAVMIGIVRQHYKFTPFAEL
LEMTDFEHRIPTYQWWMKLRPLLKVLAKHESTYEEEGLYITVEEMDVDNDSLV
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcagcagttcgagcagttgttagaatgggtatttatcttggatgtaaagttttc
tttattaaagaaggctatcagggtatggtagatggtggaaaaaatattcaagaagctact
tggtcatccgtttcttctatcatacataaaggtggtacaataataggatctgctcgatgt
catgactttgaagatcacgctggtcgcaaaaaagctgcaaaaaatttagtaaaacttgga
ataagtaatttagttgtaataggtggtgatggttcacttactggtgcaaatctatttaag
gaagaatggtcaaccttattaaaagaattagctgaagaaggagaaattacaatagaccaa
gtagaaaaatatgaacatttacacattgctggcttagtgggatctattgataatgatttt
tgcggaactgacatgactatcggtactgattctgcgttacatcgtattatcgaaagtatc
gatgctattgttagtacagcatattcccatcaaagaacattcataatggaagttatgggt
cggcattgcggttacctggccctagtggcagccatatgttctgaagctgattttgtgttc
atcccagagtggccacctgaacaagattggcccaataagctgtgcaaaaaattattacag
gaaagacttatgggacaacgacttaatattataattgtagctgaaggtgcattagataga
aatggtgaaccaattactgctgaanaaattcataaagttgttcgagaaaagctacaacaa
gatacaagaattactgttcttggtcatgttcaaagaggtggtaatccatctgcttttgat
agagttttgggctgtcgaatgggagcagaagcagtaatggcattaatggaagcaaaacca
gatactgaagcatgtgttgttacattaaatggcaatcaagctgtaagattacctcttatg
gaatgtgttcgacgtactaagggagtagcaaaagctatggccgataaaaattggaatctt
gcagttcaacttcgtggaaagggatttgctcgtaatttggaaacatataaaatgttgacc
cgtctgaaagcacctatagaatgtaccaatcccaataaggaaagtaacagtcccacatta
acaaagcaattcactttgtatggacaaagttgccattatacattaggtgtaatacatatt
ggttcaccttcttgtggtatgaatgccgctgtgcgttcttttgttagaaattgtatttat
cgaggagataaggtttatggtatttgtgacggaatcttgggtcttataactggaaaattt
aaattattggattggccttttgtcactggttgggtatcacaaggtggtgctcttttagga
actaaacgtgctccaccaaaagaggatcagttaacacagattgctcagagacttaaagaa
tatgaaattcaagctctacttattgtaggaggatttgagggttatcaaacaggacttact
tttattaatgctagagataaatttgaagaatttcgaattcctattgcaatgattccggca
actattagcaataatgttccaggaactgaattttcattaggatgtgatactgctttaaat
gaaattacggagatctgtgatcgaatccgtcagtctgcacaaggtacaaagcgtcgagta
tttattattgaaactatgggtggatattgtggttatttagctactttggctggattagct
ggtggagctgatgcagcatatattttcgaggaaaagtttaatattaaagatttaaatcaa
gatgttattgcaatggctgctaaaatgtctgaaggtgtacagagaggtcttattttaaga
aatgaaaatgcaaatttaaattatagtacagattttatgcaaagactttttagtgaagaa
ggaaaaggcctctttagctgtagaatgaatattattggtcatatgcagcaaggaggttca
ccaactccatttgatcgaaatttgggcacaaaaatgggttctaaagcagttgaatggttt
agtgaacaactaaaaaaaaatactgatgctaatggtaaagtaacagcaatggatgctgat
agtgcagttatgattggtattgtgcgacaacattataaatttacaccattcgcagaactt
cttgaaatgacggattttgaacatcgcattccaacatatcaatggtggatgaaattacga
ccattacttaaagttttagcaaaacacgagtctacatatgaggaagaaggtctttatatc
actgtagaagaaatggatgttgataatgattctcttgtataa

DBGET integrated database retrieval system