KEGG   Apis mellifera (honey bee): 724789Help
Entry
724789            CDS       T01057                                 

Gene name
GB11693
Definition
STAM-binding protein-like
Orthology
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
ame  Apis mellifera (honey bee)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ame00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    724789 (GB11693)
Enzymes [BR:ame01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     724789 (GB11693)
Peptidases [BR:ame01002]
 Metallo Peptidases
  Family M67
   724789 (GB11693)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG15
AA seq 405 aa AA seqDB search
MNKETSEIKNAKHPPWKDVGISDPRARLKSLSDYASTVEMDRNIPPQRYYRSGVEMIRMA
DMCMKDNNLEYAYFLYVKFITIFVEKIRNHPQFDTVPLKDKEHNQQTLRKVLPKAEELKK
QLLEQYQTELNKYMEDVKEREKIEKERQKREELEKLREEEERKNKLAALAAVKAAKAALT
VTIEDDKSKKISTILSKPITPSIDITAQTSKEKPIIDRSTKPSLLCDTFTLRDIILPTKL
MHNFLMLAFTNTMNNKETCGILAGKLEKNRLLVTHLLIPEQTGSPDSCVTHNEEDIFDYQ
DQHNLITLGWIHTHPTQTAFLSSVDLHTHCAYQLMMAEAIAIVCAPKYDETGFFILTPEY
GLEFIANCRETGFHPHPTDPPLYTKAKHCKLDVTAVIEVVDLRRK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggaaacgtcagagattaaaaatgctaaacatcctccttggaaggatgttggc
atatcagatccacgagcacgattgaagtctctttctgactatgcttctactgtggagatg
gatcgtaacattccaccacaaagatattaccgttctggtgtagaaatgattagaatggca
gatatgtgtatgaaagataataatcttgaatatgcatattttttatatgtcaaatttata
acaatttttgttgaaaaaataagaaatcatccacaatttgatacagtaccattaaaggat
aaggaacataatcaacaaacattacggaaagtacttcccaaggctgaggagttaaagaaa
caattattagaacaatatcaaacagagttaaataaatatatggaagatgtaaaagaaaga
gaaaaaattgaaaaggaacgacaaaaacgagaagaactagaaaaattgagggaagaagaa
gaaaggaagaacaaattagctgcactagcagctgttaaagcagcaaaagctgctttaact
gtgaccattgaagatgacaaatctaaaaaaatatccactatattatcaaaaccaataact
ccatctattgatataactgcacaaacatcaaaagaaaaacctattatagatcgctcaaca
aaaccttctttactttgtgacacttttactttaagagatataatactgccaactaaatta
atgcataactttctcatgttggcttttactaataccatgaataataaagaaacttgtggt
atactagcaggaaaattagaaaaaaatagattactagttactcatttattaattcctgaa
caaactggatctccagattcttgtgtaacacataatgaagaagatatatttgattatcaa
gatcaacataatttgattactcttggttggatacatacacatcctacacagactgcattt
ctgtctagtgtagatcttcatacgcattgtgcatatcaacttatgatggctgaagcaatt
gcaattgtttgtgctcctaaatatgatgaaacaggattcttcattttaactccagaatat
ggattggaatttattgcaaattgcagagaaactggatttcatccacatccaactgatcca
ccattatacacaaaagcaaaacattgtaaattggacgtaacagcagttatagaagtagtg
gatttaagaagaaaatga

DBGET integrated database retrieval system