KEGG   Apis mellifera (honey bee): 724870Help
Entry
724870            CDS       T01057                                 

Gene name
GB19444
Definition
NADPH--cytochrome P450 reductase-like
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     724870 (GB19444)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG8
AA seq 753 aa AA seqDB search
MMFYMYICLCVYTLCYMLRDVHATQTQSANDLLIFHSACTRHGYVHHLSITLRAYCQLHA
RCCAVNGLQPKAIRMAGSPVLENEDKTEILDEPLFSTLDIILLSALLLAALWWLMRRNKQ
EEYTPVTKSYSIQPTIFPTTQTSENSFIKKLKTSGRSLVVFYGSQTGTAEEFAGRLAKEG
IRYKMKGMVADPEECDMEELIHLKTIPNSMAVFCLATYGEGDPTDNAMEFIDWLKNGDPD
LNGLNYAVFGLGNKTYEHYNEIALYVDHRLEQLGATRVFELGLGDDDANIEDDFITWKDK
FWPTVCEFFGIEGAGEDVSIRQYKLTEHIDLSIERIYTGEIARLHSFKNQRAPFDAKNPF
LAPVKINRELHGSTSDRSCMHIEFDIEGSKMRYETGDHLAVYPVNNTELVNKIGEKCGIN
LDTVFTLTNTDEESTKKHPFPCPCSYRTALTHYLDITSNPRTHVLKELAEYCSDPNDKEK
LKLMASTSVDGKAAYQQWVVQENRNIVHILEDIPSLKPALDHLCELLPRLQCRYYSISSS
PKLHPSSIHITAVVVEYKTPTGRINKGVTTSWLKEKHPSHPPCYVPIFVRKSQFRLPTRL
STPIIMVGPGTGIAPFRGFIQERDLARKEGKEVGNTILYFGCRKKDEDFLYKDELEEYVK
RGTLILHTAFSREQSQKIYVTHLLEKNKDELWEIIGEQNGHIYVCGDAKNMARDVHNILL
KVVMEKGKMSELDAANYIKKMDSQKRYSSDVWS
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgatgttttatatgtacatatgtttatgtgtatatactttatgctatatgctacgtgac
gttcatgcaacacaaactcagtcggccaatgacttgctgatttttcattctgcttgtaca
cgacacggatatgtgcatcatctcagcattaccttgcgagcttactgccagttacacgct
cgttgttgcgctgtaaacggattacaacctaaagcgataagaatggcaggttctccagta
ttggagaatgaggataaaacagagattcttgatgaacctctctttagcactcttgatatt
atccttctcagtgctcttttattggctgccctatggtggttgatgcgccgaaacaaacaa
gaggaatatacacctgtcacaaaatcttattctattcagccaacaatatttcctacaacg
caaacatcagaaaattcatttataaaaaaattgaaaacttctggacgaagtttagtagta
ttttatggtagtcaaactggaactgcagaagaatttgccggtaggttagccaaggaaggt
attcgatacaaaatgaaaggcatggtggctgatccagaagaatgtgatatggaagaatta
atacatctcaaaacaataccaaacagtatggcagtattctgtttagcaacttatggagaa
ggtgatcctacagacaatgctatggaatttattgattggctaaaaaatggtgatcctgat
ttaaatggattaaattatgcggtatttggtcttggaaataaaacatatgaacattataat
gaaatagctttatatgttgatcatagattagaacaacttggtgctactcgtgtctttgaa
cttggtttgggagatgatgatgctaatatagaagatgattttattacatggaaagataaa
ttttggccaacagtttgtgaattctttggaattgaaggtgcaggagaagatgttagtatt
agacagtataaactaacagaacatatcgatttatcaattgaacgcatttatactggtgaa
atagctcgtcttcattcatttaagaatcaaagagcaccatttgatgcaaaaaatcctttc
ctagctccagtaaaaataaatcgtgaacttcatggttcaacttcagatagatcatgtatg
catatagaatttgatatagaaggatcaaaaatgcgatatgaaactggtgatcatttagca
gtatatcctgtaaataatacggaattagtaaataaaattggagaaaaatgtggtataaat
ttagatacagtgtttactcttacaaatacagatgaggaatctaccaagaagcatccattt
ccttgtccatgttcttacagaactgctttgacacattatttagatattactagtaatcca
cgcactcatgttctgaaagaattagcagaatattgtagtgatccaaatgataaagaaaaa
ttaaaattaatggcatcaaccagtgtggatggtaaagctgcttatcagcaatgggtagtt
caagaaaatagaaatattgtacatattttagaagatattcctagcttgaagccggccttg
gatcatctttgcgaacttttaccaagattgcaatgtcgatattattcaatttcctcatct
cctaagttacacccatcttcaattcatattactgcagttgttgtggaatataaaacacca
acaggtagaattaacaaaggtgtaactactagctggttaaaagaaaaacatccttcacat
ccaccatgttatgttcctatttttgttcgaaaatctcaatttcgtttaccaactcgatta
tcaactcctattatcatggttggtccaggtactggaatagcaccatttagaggttttata
caagaacgtgatcttgcaagaaaagaaggaaaagaagtaggaaatacaattttatatttt
ggatgtagaaaaaaagatgaagattttctttataaagatgaacttgaagaatatgtaaaa
agaggtactttaattttacatactgcatttagtagagaacaatctcagaaaatatatgtt
acacatctactagaaaaaaataaagacgaattgtgggaaattattggagaacaaaatgga
catatctatgtgtgtggtgatgcaaaaaatatggcacgagatgtacacaatattttatta
aaagttgtgatggaaaagggaaaaatgtcggaattagatgcagcgaattatatcaagaaa
atggattcgcaaaaacgttattcaagtgacgtatggagttga

DBGET integrated database retrieval system