KEGG   Apis mellifera (honey bee): 725178Help
Entry
725178            CDS       T01057                                 

Definition
chitooligosaccharidolytic beta-N-acetylglucosaminidase-like
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ame  Apis mellifera (honey bee)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    725178
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    725178
   00603 Glycosphingolipid biosynthesis - globo series
    725178
   00604 Glycosphingolipid biosynthesis - ganglio series
    725178
   00511 Other glycan degradation
    725178
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    725178
Enzymes [BR:ame01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     725178
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG9
AA seq 599 aa AA seqDB search
MIILLLIIFVVQVKTNENVEKFYSFPWHYKCENGLCKKELITKEVITPTSLEVCELFCDA
SSSLWPKPTGHLSLSKYMVQLDPDKILLVDLQNGTQIKYLLEKNIFLLKNNVKNSGKLAK
NGGMSMLIRCTGYEEINNIKLTLDTDESYTLTVIQIDEMLLEATITAKSYFGARHALETL
NQMIVFDDLRNEIQIPNEISIIDGPVYPYRGILLDTSRNFIDKATILRTIDGMAMSKLNT
LHWHITDSHSFPYVSKTWPNFSKFGSYSPEKIYDENDVKEIIEYGLIRGIRILPEFDAPA
HVGEGWQWIGNDTIVCFKAEPWKDYCVEPPCGQLNPANDKVYEILEGIYKDIMLDFQPDL
FHMGGDEVNINCWRSSTSITNWMQTVKHWDLSESSFYKLWHYFQEKAIDKLKIANNGKEI
PVILWTSGLTNEENIKYLDPSKYIIQVWTTKNDPVIDRLLRNNFKVIISNYDALYLDCGF
SAWVGEGNNWCSPYKGWQIIYENSPLKIIKLHHLENKKNLILGSEAALWSEQVDSASVDA
KIWPRSAALAERLWSEPDSGWIHAEHRMLRHRERFVKRGISAESLQPEWCLQNQGHCYA
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgatcattttgttacttattattttcgttgttcaagtcaaaacaaatgaaaatgttgag
aaattctatagttttccatggcattataaatgtgagaatggtctttgtaaaaaagaatta
attacaaaggaagtaattacacctacttcattggaagtatgtgaattattttgtgatgca
tcaagttccttatggccaaaaccaactggtcatttatctttgagtaaatatatggttcaa
cttgatcctgataaaattttattagtagatttacaaaatggaacacaaattaaatatcta
ctcgaaaaaaatatatttttattaaaaaataatgtgaaaaatagcggtaaattagcaaaa
aatggtggaatgagtatgcttattcgatgcacgggttacgaagaaataaacaatattaaa
ttaactttggatacggatgaaagttacactttaactgtaatacaaatagatgaaatgcta
ttggaagcaactattacggcgaaatcatatttcggtgcaagacatgctttagaaacatta
aatcaaatgattgtttttgacgatttaagaaatgagattcaaattcctaatgaaatatca
attattgatggacctgtatatccgtatcgtggtatattattggatactagtagaaatttc
attgataaggcaacaatattacgaacaattgatggcatggccatgtcaaagttaaatact
ttgcattggcacattactgattctcacagttttccttatgttagcaaaacatggccgaat
ttttcgaaatttggttcttactcgcctgaaaagatttatgatgaaaatgatgtgaaagaa
atcattgaatacggtcttattcgcggcattagaatattgccggaattcgatgcccctgct
catgtaggagaaggttggcaatggatcggaaatgatacaatcgtttgctttaaagcggaa
ccatggaaagattattgcgttgaacctccttgtggtcaattaaatccagctaatgataaa
gtgtatgaaattctcgaaggaatatataaagatataatgttggattttcaaccagatttg
tttcatatgggtggagatgaagtgaatataaattgttggagatcttcgacttctattaca
aattggatgcaaactgttaaacattgggatctatcagaatcaagtttctataaactttgg
cattattttcaagaaaaagcaattgataaattaaaaattgctaataatggaaaagagata
cctgttattttgtggactagtggcttaacaaatgaagaaaatattaaatatttagatcct
tcaaaatatataattcaagtttggacaaccaaaaatgatcctgttattgatagattgttg
cgaaataattttaaagtaattatttctaattatgacgctctctatttagattgtggtttt
tcagcctgggtaggtgaaggtaataattggtgttctccttacaaaggatggcaaattatt
tatgaaaattctcctttaaaaataataaaattgcatcatttggaaaataaaaaaaattta
atattaggaagtgaagcagctctttggtcagaacaagttgatagtgcatcagtcgatgcg
aaaatttggcctagatccgcggcacttgctgagagattgtggtcagaaccagattcaggt
tggattcatgcggaacatagaatgcttaggcatagagaacgatttgtaaaaagaggaatc
agtgcagaaagcttacaacctgaatggtgtttacaaaatcaaggccattgttatgcataa

DBGET integrated database retrieval system