KEGG   Apis mellifera (honey bee): 725344Help
Entry
725344            CDS       T01057                                 

Definition
histone H2B-like
Orthology
K11252  
histone H2B
Organism
ame  Apis mellifera (honey bee)
Brite
Exosome [BR:ame04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   725344
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG1
AA seq 123 aa AA seqDB search
MPPKASGKAVKKAGKAQKNISKSDKKKKRRRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDVFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgccacctaaagcaagcggaaaagctgtgaagaaagctggtaaagctcagaagaatatt
agcaagtctgataagaaaaagaagaggaggaggaaggaaagttatgctatttacatctac
aaggtgttgaagcaagttcatcctgatactggaatttccagtaaagccatgagcatcatg
aacagctttgtaaatgatgtttttgagcgtattgcggccgaagcttcacgtttagcacat
tacaacaagagatctaccatcacttctcgggaaatccaaactgctgtcaggcttctgttg
cctggtgaattggctaaacacgctgtttctgagggtactaaagccgtcaccaagtacacc
agttcaaaataa

DBGET integrated database retrieval system