KEGG   Apis mellifera (honey bee): 725418Help
Entry
725418            CDS       T01057                                 

Gene name
RPA2, GB13976
Definition
replication protein A2
Orthology
K10739  
replication factor A2
Organism
ame  Apis mellifera (honey bee)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:ame00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    725418 (RPA2)
   03420 Nucleotide excision repair
    725418 (RPA2)
   03430 Mismatch repair
    725418 (RPA2)
   03440 Homologous recombination
    725418 (RPA2)
   03460 Fanconi anemia pathway
    725418 (RPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG1
AA seq 246 aa AA seqDB search
MWSTNLNTSINSDGGFLSNTRKDGQGGNVQRVQTLIPVTIKLLHSISPIEDPTFWGIKAR
MFTFVGLIRNVEETATKISYDIEDDTGTITALKWLEANKQETDRVAEVNTYVRIVGMLRE
QNDKRHILILRLLPLQNLNELTNHILEVIYASLKAEAKLNKNRKLKKNSTNEVSNEDDLH
YGMSSQQSLVYKIIYAQNDTECGIERSEIKKKVPKSILSDVDNIIEFLVSEGHIYTTSTD
DHFKTT
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgtggtcaacaaatttaaataccagtataaattctgatggtggatttctgagtaatact
cggaaagatggacaaggtggaaatgtacaaagagttcaaactcttattccagtgacaata
aaattgttacattctatttctcctattgaagatccaacattttggggtattaaagcacgt
atgtttacatttgttggattaatacgcaatgttgaagaaacagcaacaaaaatatcatat
gatattgaagatgatacaggtactataactgcactcaagtggttagaagcaaataaacaa
gaaacagatcgtgtagcagaagtaaatacatatgttcgtatagttggtatgcttagagaa
caaaatgataaacgtcatattttaattttacgattattgccattacaaaatttaaatgaa
ttaacaaatcatattcttgaagttatttatgcttcattgaaagctgaagcaaaacttaat
aaaaacagaaaattaaaaaagaatagtacaaatgaagtatcaaatgaagatgatcttcat
tatggaatgtcatcacaacaaagtttagtttataaaattatttatgcacaaaatgatact
gaatgtggtattgaaagatctgagattaagaagaaagttccaaaatcaattttatcagat
gtagataatattatagaatttttagtttctgaaggtcacatatatacaacaagtacagat
gatcattttaaaacaacttaa

DBGET integrated database retrieval system