KEGG   Apis mellifera (honey bee): 725756Help
Entry
725756            CDS       T01057                                 

Gene name
GB17852
Definition
beta-galactosidase
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
ame  Apis mellifera (honey bee)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    725756 (GB17852)
  Lipid metabolism
   00600 Sphingolipid metabolism
    725756 (GB17852)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    725756 (GB17852)
   00604 Glycosphingolipid biosynthesis - ganglio series
    725756 (GB17852)
   00511 Other glycan degradation
    725756 (GB17852)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    725756 (GB17852)
Enzymes [BR:ame01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     725756 (GB17852)
Exosome [BR:ame04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   725756 (GB17852)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG16
AA seq 644 aa AA seqDB search
MWPVLLTLAVTTTLGEVVNVHVNNDTQWKLGFEVDYENDRFLLDGKPFRYVSGSFHYFRT
PRQYWRDRLKKIRAAGLNAVSTYVEWSLHQPSENEWYWTGNADLVEFLNIAQEEDLFVLL
RPGPYICAERDFGGLPYWLLTRVPDINLRTNDPRYMKYVEIYLNEVFKRVIPYLRGNGGP
IIMVQVENEYGSYSCDKEYLHRLRDIMKRKIGTKALLYTTDGSNMNMLNCGSISDVYTTI
DFGTNANVTKNFEIMRLYQPRGPLVNSEFYPGWLTHWQEPFQRVNVTIVAKTLNEMLSLG
ASVNIYMFYGGTNFGYKAGANGGENAYNPQLTSYDYDAPLTEAGDPTSKYFEIRNVVSKY
LPLPNVSLPTVSPKGDYGSILLSPILKLFEPQGRQLFGTIIVQGSHPLTFEALGLSHWLV
LYETNIIHSPKDPAILHAKVRDRALVYVDDHLVGTLSRTSNIYHLSIEEPYGQKLKLLIE
NQGRLNYGNGLRDFKGVTNVSLNNIPLGPWRMTGFLLDSVNPLINVNSNISVSGTLHDGP
VILRGTFSISDQPMDTYLNTDGWGKGVAFVNGHNLGRYWPLVGPQITLYIPASFLRIGEN
EIVLVELEYVPSSEKIKLQKEPILDFGAQYSNNGDNSNDIRVLV
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgtggccagttttgttgaccttggcagtgacgactactctgggagaagtggtgaatgtt
catgtgaacaatgatacacaatggaaacttggattcgaagtcgattatgagaacgatcgt
tttctattggatggaaaaccttttcgatacgtttccggtagttttcactattttcgaact
cctagacaatattggagagatcgtttaaaaaaaattagagcagctggattaaatgccgtt
tcaacttacgtggaatggagtcttcatcaaccgagtgaaaatgaatggtattggacgggt
aatgcggatttagtagaatttttaaatattgctcaagaagaagatttgtttgttctttta
agaccaggtccttatatttgcgcggagcgagattttggtggtcttccttactggttattg
acacgagtaccagatataaatttacgtacaaacgatccacgatacatgaaatatgtggaa
atatatttaaacgaagtatttaaaagagtcattccctatctcagaggaaatggaggacct
ataataatggttcaggtggaaaatgaatacggaagttactcgtgcgataaagaatattta
catcgtttgagagatataatgaaacggaaaattggtacaaaggcgcttttatatacgaca
gatggatcaaatatgaatatgctgaattgtggctctatatcagatgtttatacaactatc
gattttgggactaacgcgaacgtgacgaaaaatttcgaaataatgcgtctgtatcaaccg
cgaggcccattagtaaattcagaattttatcctggatggttgacacattggcaagaacca
tttcaaagagtaaatgttacaatagttgcaaaaactttaaatgaaatgctgtctttaggt
gcttctgttaatatttatatgttttacggtggaacgaattttggttacaaagctggggct
aatggtggcgaaaatgcatataatccacaactaacttcctatgattatgacgctccgtta
accgaagctggtgatccaacatcaaaatattttgagattcggaatgtcgtatctaagtat
ttgccactgccaaacgtgtcacttccaacagtgtctccgaaaggagattacggttcgatt
ctattgtcgccaatcctgaaactattcgaacctcaaggtcgacaattattcggaacaatt
atcgtccaaggatcacatccactaacgtttgaagcgttgggattatctcattggttggta
ttgtacgagactaacataatacatagccctaaggatcctgcaattctgcacgcaaaagtt
cgagatagagcattagtctatgtagatgatcacttggttggaactttaagtcgtaccagt
aacatctatcatttaagtatagaggagccttatggacaaaaactgaaattattaatcgaa
aatcaaggaagattaaattatggaaatggacttcgcgattttaagggagttacaaatgta
tctctaaacaatattccccttggaccttggagaatgactggatttttgctggacagcgtc
aacccgcttatcaacgtcaattccaacatatccgtaagcggaactcttcacgatggtcca
gtcatacttcgaggaactttctcgatctctgatcaaccgatggacacgtatttaaacact
gatggttggggcaaaggagttgcttttgtgaatggacataatttaggtcgatactggcca
ttggttggccctcaaataactctttatattcctgcatcttttttaagaataggcgaaaat
gagatagtgttagtcgaattggaatacgtaccaagcagcgagaaaattaaattgcaaaag
gaaccgatactcgacttcggtgctcaatattcaaataacggagataattcgaacgatata
cgtgttttggtttga

DBGET integrated database retrieval system