KEGG   Apis mellifera (honey bee): 725780Help
Entry
725780            CDS       T01057                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase calypso
  KO
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     725780
Peptidases [BR:ame01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   725780
Ubiquitin system [BR:ame04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    725780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BEEBASE: 
Position
LG11
AA seq 605 aa AA seqDB search
MPVDINRLTEGWLELESDPGLFTLLLEDFGVKGVQVEEIYDLQKSLEGPVYGFIFLFRWI
EERRSRRKVVEQDESFVKDEEIVNNIFFAQQVVPNSCATHALLSVLLNCPNIHLGTTLSR
LKMHTSGMCPENKGWAIGNTPELACAHNSHAMPQAKRRQDKNTGVSTGRFTGEAFHFVSY
VPINGRLFELDGLKPYPMDHGPWKEHEEWTEQFRRVITDRLGMATGEQLQDIRFNLMAVV
PDRRLAISHKLTMLKTNRQIVLEALQQLVKLSHQDGTEKNSNDSDKSDKSYDKKNKTDDE
NVPPNKSEIDESSSVPTITVERNSDSTIDTEEPATSVTSGKAESNMEKVVMCALDYATPL
RIQTSPAHSSSSTDTSSEIGSAFNSPTQAWGWNSGQSSPTSTKDFKKFVVIRVSGDEKNE
AGLIGRSLGNININGKRLVSDSGHLHKKVCLSGEVRIPHARVKTSNGDTVTEEKKVEKID
PKLCSKYPELFEPHTFAPKDLLALLKNLEHEINICETSLKDENDKRNKYKIDDCRRTHNY
DEFICTFLSMLAQQGKLAELVQQHLTLKKHTSVSVNRVHRSSKKADTRPNSSRRRRGRTK
CKKRK
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgccagttgacataaatcgattaacagaaggttggctagaattggaaagtgacccaggt
ttatttacattattattggaagattttggagtaaaaggtgtacaagtagaagaaatatat
gatctacaaaaatcattagaaggtccagtatatggttttatatttttatttcgttggata
gaagaaaggagatccaggcgtaaagttgtagaacaagatgaaagttttgtaaaagatgaa
gaaattgttaacaatatattttttgcacaacaggttgtgcccaatagttgtgcaactcac
gcattactttctgtattacttaattgtccaaatattcatttgggtacaactttatcccga
ttgaaaatgcatacatctggtatgtgtccagaaaataaaggatgggcaattggaaatact
cctgaattggcatgtgctcataattctcatgcaatgcctcaagccaaaagacgtcaggat
aaaaatactggtgtttcaactggtagatttactggagaagcttttcattttgttagttat
gtaccaattaatggtagattatttgaattagatggtttaaaaccatatccgatggatcat
ggtccatggaaagagcatgaagaatggactgaacaatttagaagagtaattacggatcgt
ttaggaatggcaacaggggaacagttacaagatataagatttaatttaatggctgttgtt
cctgatcgacgactcgccatttcgcataaattaactatgttgaaaactaataggcaaata
gtattagaggcattgcaacaacttgttaaattaagtcatcaagatggaacagaaaaaaat
tcaaatgattctgataaatcagataaatcctatgataaaaaaaacaaaaccgacgacgaa
aatgttccacctaataaatcagagattgatgaatcttcatcagtaccaactattacagtt
gaaagaaacagtgattctactatagatactgaagaaccagccacaagtgtaacttctgga
aaggcagaatcaaatatggaaaaagtagtaatgtgtgcattggattatgctacacctctc
agaattcaaacttccccagcacatagttcgtctagtactgatacatcatctgagattgga
tctgcatttaattctccaactcaagcatggggatggaattctggtcaaagcagcccaaca
tcgacaaaagatttcaaaaagtttgtcgtgattagagtgtctggtgatgaaaagaacgag
gctggtttaataggtcgttctcttggaaatattaatataaatggaaaaagattagtttct
gacagtggtcatttacataagaaggtctgcctgtcaggagaagttaggatacctcatgcc
agagtaaaaactagtaacggggatactgttaccgaagagaagaaagtcgaaaagatcgat
ccgaaattatgttcaaaatatccagaattgttcgagccccatacatttgcacctaaagat
cttttggcattgttaaagaatttggagcatgaaattaatatctgtgaaactagtttaaaa
gatgaaaatgacaagaggaataaatacaagattgatgattgtcgtagaacacacaattac
gacgaatttatttgcactttcctttcgatgcttgctcaacaaggcaaattggcagaatta
gtccaacaacacttgactttaaagaagcatacttccgtctcagtgaacagggttcataga
tcttcaaagaaagcagatactcgtccaaactcgtcccgtagacgtcgaggtagaaccaaa
tgtaaaaaacgaaaataa

DBGET integrated database retrieval system