KEGG   Apis mellifera (honey bee): 726095Help
Entry
726095            CDS       T01057                                 

Gene name
GB16372
Definition
alpha (1,2) fucosyltransferase
Orthology
K00718  
galactoside 2-L-fucosyltransferase 1/2 [EC:2.4.1.69]
Organism
ame  Apis mellifera (honey bee)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - lacto and neolacto series [PATH:ame00601]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:ame00603]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG15
AA seq 339 aa AA seqDB search
MHIRISSHSQQHILASAIFLAMIVVISIHVFLFPMYTYNPPAHHIKISSYEQALCHTSSK
NINIPPKWEYPCPKYGIVSAIQGGRLGNQIWEYASVWATARRTGLEPFMPHCILKTLEEY
FENLSIPPLNYIGKCNLDVNQIVNSLGQWNSTEQNIIIPRHAAYWSLILVWLDDVRREFT
FKPNLRIYAEKVLKEIAEEFNLFEPTFVSIHIRRTDYVDYLWQKLKIRPAPVSYYYAAMD
YFIGKYDNVVFVVTSDNIVWCKYHLNSKRYRIKFVSDVDARGPGKDLAVLSACNHSIIDY
GTYGSFGAILAAGETIVYNVTTYFSTLIAEVLPNWKIMS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcatataaggatatccagtcactctcagcagcatatacttgcaagtgcaatatttctt
gctatgatagtggtcatcagcatccatgtcttcctgtttcctatgtacacatataatcca
ccagctcatcatataaagatttcatcatatgaacaagctctttgtcatacttcttcaaag
aatatcaatataccaccaaaatgggaatatccttgtcccaaatatggaatagtttctgca
attcaaggtggtagacttggaaatcaaatttgggaatatgcatcagtatgggctactgca
agaaggactggtttggaaccatttatgccacattgcatattgaaaactcttgaggaatat
tttgaaaatcttagtattcctccacttaattacattggaaagtgtaatttggatgttaat
caaattgttaattctcttggacaatggaacagtacagaacagaatattattataccgaga
catgcagcttattggtctttaattttggtgtggttggatgatgtaagaagagaatttaca
tttaagccaaatttaagaatttatgcagaaaaagtactaaaagaaatagcagaggaattt
aatttatttgaaccaacatttgtaagcatacacattcgaagaacagattatgtggattat
ctatggcaaaaattaaaaatcagacctgcgccagtcagctattattatgcagcaatggat
tactttattggcaagtatgataatgtagtttttgtagtaactagtgataatatagtttgg
tgcaagtatcatttgaatagtaaaagatatagaataaaatttgtatctgatgtggatgca
agaggtccaggtaaagatcttgcagttttatcagcatgtaatcatagtattatagattat
ggtacatatggttcgtttggcgcaattttagctgctggtgaaactattgtgtataatgta
acaacatatttttctacattaattgccgaagttttgccaaactggaaaataatgagttga

DBGET integrated database retrieval system