KEGG   Apis mellifera (honey bee): 726095Help
Entry
726095            CDS       T01057                                 

Gene name
GB16372
Definition
alpha (1,2) fucosyltransferase
Orthology
K00718  
galactoside 2-L-fucosyltransferase 1/2 [EC:2.4.1.69]
Organism
ame  Apis mellifera (honey bee)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    726095 (GB16372)
   00603 Glycosphingolipid biosynthesis - globo series
    726095 (GB16372)
Enzymes [BR:ame01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.69  galactoside 2-alpha-L-fucosyltransferase
     726095 (GB16372)
Glycosyltransferases [BR:ame01003]
 Glycan extension
  ABO blood group
   726095 (GB16372)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG15
AA seq 339 aa AA seqDB search
MHIRISSHSQQHILASAIFLAMIVVISIHVFLFPMYTYNPPAHHIKISSYEQALCHTSSK
NINIPPKWEYPCPKYGIVSAIQGGRLGNQIWEYASVWATARRTGLEPFMPHCILKTLEEY
FENLSIPPLNYIGKCNLDVNQIVNSLGQWNSTEQNIIIPRHAAYWSLILVWLDDVRREFT
FKPNLRIYAEKVLKEIAEEFNLFEPTFVSIHIRRTDYVDYLWQKLKIRPAPVSYYYAAMD
YFIGKYDNVVFVVTSDNIVWCKYHLNSKRYRIKFVSDVDARGPGKDLAVLSACNHSIIDY
GTYGSFGAILAAGETIVYNVTTYFSTLIAEVLPNWKIMS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcatataaggatatccagtcactctcagcagcatatacttgcaagtgcaatatttctt
gctatgatagtggtcatcagcatccatgtcttcctgtttcctatgtacacatataatcca
ccagctcatcatataaagatttcatcatatgaacaagctctttgtcatacttcttcaaag
aatatcaatataccaccaaaatgggaatatccttgtcccaaatatggaatagtttctgca
attcaaggtggtagacttggaaatcaaatttgggaatatgcatcagtatgggctactgca
agaaggactggtttggaaccatttatgccacattgcatattgaaaactcttgaggaatat
tttgaaaatcttagtattcctccacttaattacattggaaagtgtaatttggatgttaat
caaattgttaattctcttggacaatggaacagtacagaacagaatattattataccgaga
catgcagcttattggtctttaattttggtgtggttggatgatgtaagaagagaatttaca
tttaagccaaatttaagaatttatgcagaaaaagtactaaaagaaatagcagaggaattt
aatttatttgaaccaacatttgtaagcatacacattcgaagaacagattatgtggattat
ctatggcaaaaattaaaaatcagacctgcgccagtcagctattattatgcagcaatggat
tactttattggcaagtatgataatgtagtttttgtagtaactagtgataatatagtttgg
tgcaagtatcatttgaatagtaaaagatatagaataaaatttgtatctgatgtggatgca
agaggtccaggtaaagatcttgcagttttatcagcatgtaatcatagtattatagattat
ggtacatatggttcgtttggcgcaattttagctgctggtgaaactattgtgtataatgta
acaacatatttttctacattaattgccgaagttttgccaaactggaaaataatgagttga

DBGET integrated database retrieval system