KEGG   Apis mellifera (honey bee): 726117Help
Entry
726117            CDS       T01057                                 

Gene name
Tpi, GB17473
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ame  Apis mellifera (honey bee)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    726117 (Tpi)
   01230 Biosynthesis of amino acids
    726117 (Tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    726117 (Tpi)
   00051 Fructose and mannose metabolism
    726117 (Tpi)
   00562 Inositol phosphate metabolism
    726117 (Tpi)
Enzymes [BR:ame01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     726117 (Tpi)
Exosome [BR:ame04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   726117 (Tpi)
  Exosomal proteins of bladder cancer cells
   726117 (Tpi)
  Exosomal proteins of melanoma cells
   726117 (Tpi)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG16
AA seq 247 aa AA seqDB search
MGRKFFVGGNWKMNGTKSEINDIVGFLKKGPLDSNVEVVVGVPSIYLTYAKNILPNNISI
AGQNTYKVAKGAFTGEISPAMLLDNGIPWVILGHSERRNIFGENDELIAEKVAHALESGL
KVIACIGEKLEEREAGKTDEVVFRQTKAIANKINSWDNVVVAYEPVWAIGTGKTATPQQA
QEVHEKLRNWFSKNVNQTVAETVRIIYGGSVTAGNAKDLAKEKDIDGFLVGGASLKPDFV
QIVNAKQ
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtaaattttttgttggtggtaattggaaaatgaatggtaccaaaagtgaaata
aatgatattgttggctttttaaaaaaaggtccacttgattcaaatgttgaggttgttgtt
ggtgtaccatctatatatttaacatatgccaagaatatattacccaataatattagtatt
gctggacaaaatacatataaggttgcaaaaggagcatttactggagaaataagtcctgct
atgcttttggacaatggaatcccatgggtaattcttggtcattccgaacgtagaaatatt
tttggtgaaaatgatgaattaatagcagaaaaagtagcccatgctttagaaagtggacta
aaggtaattgcatgtattggagaaaaattagaagaaagagaagctggtaaaacagatgaa
gtagtttttagacagacaaaagctattgcaaataaaatcaattcatgggataatgtagtt
gttgcttatgaaccagtttgggcaattggaacgggtaaaacagccacaccacaacaagct
caagaggttcatgaaaaattaagaaattggttttctaaaaatgttaatcaaactgtcgca
gaaactgttagaattatttatggaggttcagtaacagcaggaaatgcaaaagatttagca
aaagagaaagatattgatggatttttagttggtggagcatctctaaaacctgattttgta
cagatcgttaacgctaagcagtga

DBGET integrated database retrieval system