KEGG   Apis mellifera (honey bee): 726172Help
Entry
726172            CDS       T01057                                 

Gene name
GB17129
Definition
e3 ubiquitin-protein ligase IAP-3-like
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
ame  Apis mellifera (honey bee)
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:ame04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG1
AA seq 401 aa AA seqDB search
MTGIIKHRDFGNDSNLKTSTNAHLTSPLLITPHILNDEVDNIDYHFEAARLQSFENWPVS
YIEPEKLAAAGFYYTGEGDKVRCFECQVEICQWVEGDIPMVDHQRWSARCRFIRKINCGN
VPIGVDPNTIIPPRPRSRDVCGPYGLEYRLTSGPDNHNFSTELQLPSTAKLSRLGLTRPK
GPLHPEYASYDARLNTFSTWPKSMPQTKEQLADAGFYYTGKGDQTICYHCGCGLKDWEPE
DNPWEQHAKWFSKCYYLLTVKGQDYVNKITGQHVSPPSKEETIQMNLPSYITKIQPANIE
TERKEGTDSNPGSSSQDSGVKNIASNTESVKESAENLSNTKIQNSKPTDDARMCKICYNG
ELGVVFLPCGHMVACVKCAPGMISCAVCREPVTMTVRAFFS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgactggtattatcaagcacagagattttggaaatgattcaaacctcaaaacttcaaca
aatgcacatttaacatcaccacttcttataacacctcatatattgaatgatgaagtagat
aatattgattatcactttgaagcagcaagacttcaaagttttgaaaattggcctgtatca
tatatagaacctgaaaaacttgcagctgctggattttattacacaggtgaaggtgataaa
gttagatgctttgaatgtcaagttgagatatgtcaatgggtagaaggtgacattccaatg
gttgatcatcagagatggtcagcaagatgtagatttattcgtaaaataaattgtggtaat
gtaccaattggggtagatcctaacactattatcccaccacgaccaagaagtagagatgta
tgtggtccttacggtttagaatatcgacttacatctggtcctgataatcataatttttca
actgaattacaattaccaagcactgctaaacttagtcgtttaggtttgacaaggcctaag
gggcctttacatcctgaatatgctagttatgatgctagattaaacacattttcaacatgg
ccaaaatctatgccacaaacaaaagaacaattagcagatgcaggtttttattatacggga
aaaggtgatcaaactatatgttatcattgtggatgtggtttaaaagattgggaaccagaa
gataatccttgggaacaacatgcaaagtggttttctaagtgctattatttattaacagtt
aaaggacaagattatgtgaataaaataacaggccaacatgtatctccaccttcaaaagaa
gaaacaatacaaatgaatttacctagttatattacaaaaatacaacctgcaaatatagaa
acagaaaggaaagaaggcacagatagcaatccaggatcaagttctcaagatagtggtgta
aaaaatattgcaagcaatacagaatctgtaaaagaaagtgcagaaaatttatcaaataca
aaaatacaaaatagtaaacctacagatgatgcaagaatgtgtaaaatttgttataatgga
gaattaggagtagtatttttaccatgtggacatatggttgcgtgtgtaaaatgtgctcct
ggtatgatatcctgtgcagtatgcagagaacctgttacaatgactgtacgagcttttttc
tcatag

DBGET integrated database retrieval system