KEGG   Apis mellifera (honey bee): 726172Help
Entry
726172            CDS       T01057                                 

Gene name
GB17129
Definition
(RefSeq) death-associated inhibitor of apoptosis 2-like
  KO
K16061  
baculoviral IAP repeat-containing protein 7/8
Organism
ame  Apis mellifera (honey bee)
Pathway
Ubiquitin mediated proteolysis
Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:ame00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    726172 (GB17129)
 Cellular Processes
  Cell growth and death
   04215 Apoptosis - multiple species
    726172 (GB17129)
Ubiquitin system [BR:ame04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    726172 (GB17129)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG1
AA seq 401 aa AA seqDB search
MTGIIKHRDFGNDSNLKTSTNAHLTSPLLITPHILNDEVDNIDYHFEAARLQSFENWPVS
YIEPEKLAAAGFYYTGEGDKVRCFECQVEICQWVEGDIPMVDHQRWSARCRFIRKINCGN
VPIGVDPNTIIPPRPRSRDVCGPYGLEYRLTSGPDNHNFSTELQLPSTAKLSRLGLTRPK
GPLHPEYASYDARLNTFSTWPKSMPQTKEQLADAGFYYTGKGDQTICYHCGCGLKDWEPE
DNPWEQHAKWFSKCYYLLTVKGQDYVNKITGQHVSPPSKEETIQMNLPSYITKIQPANIE
TERKEGTDSNPGSSSQDSGVKNIASNTESVKESAENLSNTKIQNSKPTDDARMCKICYNG
ELGVVFLPCGHMVACVKCAPGMISCAVCREPVTMTVRAFFS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgactggtattatcaagcacagagattttggaaatgattcaaacctcaaaacttcaaca
aatgcacatttaacatcaccacttcttataacacctcatatattgaatgatgaagtagat
aatattgattatcactttgaagcagcaagacttcaaagttttgaaaattggcctgtatca
tatatagaacctgaaaaacttgcagctgctggattttattacacaggtgaaggtgataaa
gttagatgctttgaatgtcaagttgagatatgtcaatgggtagaaggtgacattccaatg
gttgatcatcagagatggtcagcaagatgtagatttattcgtaaaataaattgtggtaat
gtaccaattggggtagatcctaacactattatcccaccacgaccaagaagtagagatgta
tgtggtccttacggtttagaatatcgacttacatctggtcctgataatcataatttttca
actgaattacaattaccaagcactgctaaacttagtcgtttaggtttgacaaggcctaag
gggcctttacatcctgaatatgctagttatgatgctagattaaacacattttcaacatgg
ccaaaatctatgccacaaacaaaagaacaattagcagatgcaggtttttattatacggga
aaaggtgatcaaactatatgttatcattgtggatgtggtttaaaagattgggaaccagaa
gataatccttgggaacaacatgcaaagtggttttctaagtgctattatttattaacagtt
aaaggacaagattatgtgaataaaataacaggccaacatgtatctccaccttcaaaagaa
gaaacaatacaaatgaatttacctagttatattacaaaaatacaacctgcaaatatagaa
acagaaaggaaagaaggcacagatagcaatccaggatcaagttctcaagatagtggtgta
aaaaatattgcaagcaatacagaatctgtaaaagaaagtgcagaaaatttatcaaataca
aaaatacaaaatagtaaacctacagatgatgcaagaatgtgtaaaatttgttataatgga
gaattaggagtagtatttttaccatgtggacatatggttgcgtgtgtaaaatgtgctcct
ggtatgatatcctgtgcagtatgcagagaacctgttacaatgactgtacgagcttttttc
tcatag

DBGET integrated database retrieval system