KEGG   Apis mellifera (honey bee): 726225Help
Entry
726225            CDS       T01057                                 

Gene name
GB17920
Definition
aldose 1-epimerase-like
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
ame  Apis mellifera (honey bee)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    726225 (GB17920)
   00052 Galactose metabolism
    726225 (GB17920)
Enzymes [BR:ame01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     726225 (GB17920)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG11
AA seq 313 aa AA seqDB search
MSVAETFIEEDGFGFVPRPDRNKHNQSYEIVRRYTMTNKHKASVQLISWGATIQAIKIPN
QAGILGDVVLGFDDVEGYLKNRYIGSTIGRVANKISMGKMKINNKDYSLTINDKNSTSHY
NGGFVAFDNVNWNSYVFKKHVVMTHTSTKNSEGYPGDLLTQIKYSWTDDNQLIINIRACA
TEPTPVNITNNCLMNLAGHATGPKELRKHVISLNAASWTFTDIINELPTGAIYPVDRTVF
DLRLPTQLTKRKLYIIPGGGYNQNLCITNFNSWFYRFHARAISQRGQQPIFRAFGCAITC
ARLPHFISGLHQD
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtggcggaaacgtttatagaggaagacggtttcggcttcgttcctaggcctgac
cgcaataaacacaaccaatcgtacgaaattgttcgaaggtacacgatgacgaacaagcac
aaagcgtcggtgcaattgatatcttggggcgctactatccaagccatcaagataccgaat
caagcgggcattttgggcgacgttgttctaggattcgacgacgtggagggatatttgaag
aacaggtacatagggagcacgattggccgtgtcgcgaataaaatttctatggggaaaatg
aagatcaacaacaaggattactctctgactataaacgacaaaaatagcacgagccattac
aacgggggtttcgtcgcgttcgacaacgttaattggaattcttacgtattcaagaagcac
gtggtgatgacccacacgagtacgaaaaacagcgagggatacccgggtgatctgctcacg
cagattaaatattcctggacggatgataatcagttgatcataaatatccgcgcttgcgct
accgaaccgacacctgttaacattactaataattgtttgatgaatcttgctggacatgct
actggcccgaaggaattgagaaaacacgtaatctcgttgaacgctgctagctggacattc
acggatattataaatgaattgccgacaggtgctatatatccggttgatcgtacggtattc
gacctacgcttaccgactcagttaaccaagagaaaactttacatcataccggggggtggt
tacaaccagaacctttgcataaccaacttcaacagttggttttatcgtttccacgctaga
gcaattagtcaacgaggtcaacaaccaatatttcgagcgttcggttgcgcaattacatgt
gcacgcttgccacattttatttcgggattgcatcaagattga

DBGET integrated database retrieval system