KEGG   Apis mellifera (honey bee): 726269Help
Entry
726269            CDS       T01057                                 

Gene name
Gtpx2, GB18955
Definition
glutathione peroxidase-like 2
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ame  Apis mellifera (honey bee)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    726269 (Gtpx2)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    726269 (Gtpx2)
Enzymes [BR:ame01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     726269 (Gtpx2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG5
AA seq 201 aa AA seqDB search
MQKLIFLTVLFFCGVIGENCEDNNKKEECALAPLDQDKNWKSASTIYDFHAKDIHGNDVS
LNKYRGHVCIIVNVASNCGLTDTNYRELVQLYEKYNEKEGLRILAFPSNEFGGQEPGTSV
EILEFVKKYNVTFDLFEKINVNGDNAHPLWKWLKTQANGFITDDIKWNFSKFIINKEGKV
VSRFAPTVDPLQMESELKKYF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaattgatatttctaacagttctcttcttttgtggagtcataggagaaaattgt
gaagataataataaaaaagaagaatgtgctttagcacctttagatcaagacaagaattgg
aaatcagcttctaccatttatgattttcatgctaaagatatccatggaaatgacgtgtca
ttgaataaatatcgtggacatgtttgtataattgttaatgttgctagtaattgtggactt
acagatacaaattacagagaacttgtacaattatatgaaaaatacaatgaaaaagaaggt
ttaaggattttagcatttccatcaaatgagtttggcggtcaagaaccaggaacctctgta
gaaattttagagtttgtcaaaaaatataatgttacttttgatctatttgaaaaaattaat
gttaatggagataatgcacatccattatggaagtggttgaagacacaagcaaatggattc
ataactgacgatataaaatggaattttagtaaatttattattaacaaagaaggaaaagtt
gtttctcgatttgcaccaactgttgatcctttgcaaatggaatctgagttgaagaaatat
ttttaa

DBGET integrated database retrieval system