KEGG   Apis mellifera (honey bee): 726401Help
Entry
726401            CDS       T01057                                 

Gene name
GB14246
Definition
(RefSeq) ras-specific guanine nucleotide-releasing factor 2-like
  KO
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
ame  Apis mellifera (honey bee)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BEEBASE: 
Position
Un
AA seq 1461 aa AA seqDB search
MSLVNNANKYRNGVWRPPSGDNRYYKSTCIMSQYHCFAISYRRENQRQYELRAATESDCK
TWIEAIREASFNKLLLQKEELEQKHLHLLQIVESEKTAKWQYTQQCEELASEIKKLRTEL
CALKKELRPVTSTCRPGFQRTMSQGTGSLYMSGSPFGSGGQGSGVTVFGLRDITEGSIEM
QKIKKVQSFFRGWLCRRRWKQIVEQYIKSPHAESMRKRNSLVFQMVEAEEEYTEQMEILV
SCFLRPFKMAASSKKPPCNHEDVNSIFLNSETVLFLHQIFLKGLTSRMESWPTLVLGDLF
DMLLPMLAIYQEYVRNHHYSLQVLTECKQSSSFAALLTRLENKTACGGRSLETFLTYPMH
QIPRYIITLHELLAHTPYDHVERKSLQNARQQLEDLSRQMHDEVSETENLRKNLAVERMI
VEGCDILLDVNQVFVRQGTLIQILDKPKGARSRLSATFGGKSGDKEVIRQCFLFSNHLLL
TTRQSDDDGRLNLVPQIGKIPLSDAVLVEDPNDLGTADDDASSALGLQRHSKQWMSCLVQ
NGISESSGSGSGTASSQVQNRDFKIILDLKSGGTQVIVHLVAPTIQEKAAWISDISQCMD
NVHFNDLLRGSLSDTSSVTMPQSIRNDPKLFKDDVDIRFSRTLNSCKVPQIRSATPERLL
QRLTDLRFLSIDFLNTFLLTYRVFTDGVTVLEALKKVFYEAEPPDSEMPTGSLVSLDVLG
VTTTDSTLHVDDRRRSSVSPRRISGDSSVSGYGSEISDSREIKSSYDYPGYTLNSKGYWR
SGYKKVDEEQQLGLISEAPPIIKRSPTIQSSSASIDSQSPATPRKISIRVDKKEEDDGCH
LTIPKVIAVSSSSETLTDNTVISAPSSPSNLSSVTLVGSTGSGSGSGSDRSPQEATYSRG
ASEETDTPVATDLPKKDEQFIYEHSEAEISKQIKANIPSTSKEKNTEVIKIEINKHEKEK
QTAKESETSVSTMQPQSPKQIQQSLQNQQKQHLHQSEHRASIASAPAATVRSSSISTITG
NYWASRRSIQEIEMSSQQGNFQHDQVSSKAGVVITSFRQSHRSIGRVPFWSSTSTAATAF
AIATSASSNPPDKGIEGNNRRGSCREKNRRKESVMSTAATMRVLNVLRHWVSKHAQDFES
DQKLKNLTIEFLEDIIYCPNLLPAEHKAASQLLRLITKEEPESSKVDLKKLLASPIVQTK
ENIETLSALEIAEQMTYLDHKIFISISSEEFLGQAWMKVDKAARAPHILLMTKRFNEVSQ
LVVSEIIRRSNMAARVAAIEKWAAVADISRVLHNYNGVLQICAAFTNSSVFRLKKTWEKV
SKTTKQTIERLQNIVSSDGRFRNLRDALHRCDPPCIPYLGLYLTDLSFIEEGTPTMTEEG
LLNFSKMRMIAHVIREIRHFQQTPYKIELITKVTNYLLDPSLLLNEKDLYRMSLEIEPRT
SRLSSSTLINLPPSVSHTSTK
NT seq 4386 nt NT seq  +upstreamnt  +downstreamnt
atgtctttagtaaataatgctaataaatatcgcaatggagtttggaggcctcctagcggt
gataatcgctattacaaatcaacgtgtatcatgtcacagtatcactgttttgcaatatct
tatagaagagaaaaccaacggcaatatgagttaagagcagctacagagtccgattgtaaa
acgtggatcgaagctatacgagaagccagtttcaacaaattactattgcaaaaagaagag
ctcgagcagaaacacttacacttgttgcaaattgtcgagagcgagaagacagctaaatgg
caatatacacaacaatgcgaggaacttgcgtcagaaataaagaaacttcgaacagaattg
tgtgctctgaagaaggaattaagacctgtaacttcaacatgtagaccgggatttcaaaga
actatgtcccaaggcactggcagtttatacatgtcgggatctccttttggttccggaggg
caaggttcaggagttacagtgtttggattacgagatattactgagggctcgatcgaaatg
cagaaaattaaaaaggttcagagctttttcagaggatggctatgtcgtaggcggtggaag
caaatcgtcgagcagtatattaaaagccctcatgcagaaagcatgcgtaaacgaaatagt
ttagtatttcaaatggtggaagcagaagaagaatacacagaacaaatggaaatattagta
agctgtttcttgagaccttttaagatggctgccagttcaaagaaacccccttgtaatcat
gaggatgtgaatagcatatttttgaatagcgaaacagtgttgttccttcatcagattttc
ttgaaaggtcttacttctcgtatggagagctggcccactttagttttaggtgatttgttt
gacatgttattacccatgttggcaatttatcaagaatatgtcagaaatcatcattacagt
cttcaagtattaactgagtgcaagcaatcctcttcatttgctgcattgctcactagattg
gagaataagactgcttgtggaggacgatctctagagacatttttaacgtatcctatgcat
cagattccaagatatatcataacattgcacgaactattagcacacactccttatgatcat
gttgaacggaaaagtttacaaaatgcgagacaacaattggaagatttgtcaagacaaatg
catgacgaagttagcgaaacagaaaatttacgaaaaaatttagctgtcgaacgaatgatt
gtagaaggatgcgatattttacttgatgtcaatcaagtattcgttagacagggtacactc
atccaaattttagataagccaaaaggagcgcgaagtagattgagtgcaacttttggagga
aaaagtggagataaggaagtaattagacaatgcttccttttttccaatcatttgttatta
acgactcgtcaatcagacgatgatggtcgtttgaatcttgttccacaaatcggaaaaata
cctctttccgatgcggtgttagtggaggatcctaatgacctgggtactgcggatgatgat
gcttcttcagctttgggactgcaacgacattccaagcaatggatgagctgtcttgtgcaa
aacggtatcagtgagagcagcggtagtggtagcggaactgccagtagtcaagtacagaac
cgtgacttcaaaattatactcgatttgaaatctggtggaactcaagttatagtacatctc
gtagctcctactattcaggaaaaagctgcgtggatcagcgatatcagccaatgtatggat
aatgttcacttcaatgatttgcttcgaggctcgttgtcagataccagttccgtcacgatg
cctcaatccatccggaatgatcctaaattgtttaaagatgatgtagacatcagattcagt
agaactttaaattcttgcaaagtcccacaaattcgatcagccactcctgagcgtctactt
caacgattaacagatttaagatttctcagcattgattttctcaatacatttttattaacg
tatcgagtatttaccgatggtgttactgtgctcgaagctttgaaaaaagtcttttatgaa
gccgaaccaccagattctgagatgcctactggttctctagtgtctctagatgtattggga
gtaactacaacagattctacattgcatgtagatgatagaagaagaagtagtgtttcacca
cgaagaattagtggagatagttcagtttctggatatggatctgaaataagtgatagtcgc
gaaataaaaagttcctatgattatcctggatatacccttaattcaaagggatattggcga
agtggatacaaaaaggtagatgaagaacagcaattaggtttaatttcggaagctcctccg
attataaaacgaagtcctactatacaatcgtcttctgcatccattgattctcaatctccc
gctacaccacggaagattagcattcgcgtggacaaaaaagaagaagatgatggttgtcat
ttaacaataccaaaagtaattgcggtttcatcaagttctgaaactctaacagataataca
gtaataagtgcaccttcctctccaagtaatcttagctctgttacgttagtcggatcaacg
ggttctggatcaggttctggatcagatcgaagtccacaagaggctacttattcacgtggt
gcctcagaagaaacagatacacctgtagcaacggatcttccaaaaaaagatgaacaattt
atctacgaacattctgaagctgaaatatcaaaacaaataaaagcaaatattccttcaaca
tcaaaagaaaaaaatactgaagtaattaaaattgaaataaacaaacacgaaaaagaaaaa
caaacagcaaaagaaagtgaaactagtgtctcaacaatgcaacctcaatctcctaaacaa
attcaacaaagtctacagaatcaacaaaaacaacatttacatcaaagtgaacatagagca
tcgattgcttctgcacctgcggctactgtaaggagtagctcgatttctacaataactgga
aattattgggcgagcagacgatcgattcaagaaatcgaaatgtcttctcaacaaggtaac
ttccaacacgaccaagtttctagtaaggctggagtagtgattactagctttcgccagagt
catcgaagcattggacgtgtacctttctggagtagtacctcgactgctgcaactgcattt
gcaattgcaacatctgcatcgagcaatcccccagataagggcatcgaaggaaataatcgt
agaggttcgtgtcgagaaaaaaacagacgaaaggaatcagttatgtcaactgcagccacg
atgcgagtattaaacgtgttgagacattgggtttcgaaacatgctcaagattttgaatct
gatcaaaagttgaaaaatctaacgatcgagttcttggaagatatcatttactgccctaat
cttctcccagctgaacataaagctgcaagccagcttcttagattaatcacgaaagaagaa
ccagaaagtagcaaagtggatctcaagaaactattagcctctccaattgtgcaaactaaa
gagaatatcgagacattgtctgcgcttgaaatcgcagaacaaatgacatacttggatcac
aagatttttatatccatttcgagcgaagaatttcttggacaagcatggatgaaagttgac
aaggctgcacgtgctcctcacattcttttaatgacaaagagattcaatgaagtgtctcag
ttagttgtttcagagattattcgccgttcaaatatggcagcacgagttgcagcgattgaa
aaatgggcggcagttgcagatattagtagagtcttgcataattataatggtgtattacaa
atttgtgcagctttcacgaatagcagtgttttcagattgaaaaaaacatgggaaaaagtt
tcaaaaacaacaaagcaaacaattgaaagattacaaaacattgtttcttctgatgggcgt
tttagaaatctacgggatgctttacatcgatgtgatccaccttgcattccttatttagga
ttatatttaaccgatctttctttcatagaagaaggtacaccaaccatgaccgaagaaggc
cttttaaatttttccaaaatgcgaatgattgctcacgtgattcgagaaatacgacatttt
caacaaacaccatacaaaattgaattgataactaaagtaacgaattatttgctggatcca
tcattgctgctaaacgagaaggatctctaccgcatgtctttggagattgaaccaagaaca
tccaggttaagtagttcaaccttaattaatctgccaccttctgtgagccacacatctaca
aaataa

DBGET integrated database retrieval system