KEGG   Apis mellifera (honey bee): 726401Help
Entry
726401            CDS       T01057                                 

Gene name
GB14246
Definition
ras-specific guanine nucleotide-releasing factor 1-like
Orthology
K12326  
Ras-specific guanine nucleotide-releasing factor 2
Organism
ame  Apis mellifera (honey bee)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
Un
AA seq 1174 aa AA seqDB search
MESWPTLVLGDLFDMLLPMLAIYQEYVRNHHYSLQVLTECKQSSSFAALLTRLENKTACG
GRSLETFLTYPMHQIPRYIITLHELLAHTPYDHVERKSLQNARQQLEDLSRQMHDEVSET
ENLRKNLAVERMIVEGCDILLDVNQVFVRQGTLIQILDKPKGARSRLSATFGGKSGDKEV
IRQCFLFSNHLLLTTRQSDDDGRLNLVPQIGKIPLSDAVLVEDPNDLGTADDDASSALGL
QRHSKQWMSCLVQNGISESSGSGSGTASSQVQNRDFKIILDLKSGGTQVIVHLVAPTIQE
KAAWISDISQCMDNVHFNDLLRGSLSDTSSVTMPQSIRNDPKLFKDDVDIRFSRTLNSCK
VPQIRSATPERLLQRLTDLRFLSIDFLNTFLLTYRVFTDGVTVLEALKKVFYEAEPPDSE
MPTGSLVSLDVLGVTTTDSTLHVDDRRRSSVSPRRISGDSSVSGYGSEISDSREIKSSYD
YPGYTLNSKGYWRSGYKKVDEEQQLGLISEAPPIIKRSPTIQSSSASIDSQSPATPRKIS
IRVDKKEEDDGCHLTIPKVIAVSSSSETLTDNTVISAPSSPSNLSSVTLVGSTGSGSGSG
SDRSPQEATYSRGASEETDTPVATDLPKKDEQFIYEHSEAEISKQIKANIPSTSKEKNTE
VIKIEINKHEKEKQTAKESETSVSTMQPQSPKQIQQSLQNQQKQHLHQSEHRASIASAPA
ATVRSSSISTITGNYWASRRSIQEIEMSSQQGNFQHDQVSSKAGVVITSFRQSHRSIGRV
PFWSSTSTAATAFAIATSASSNPPDKGIEGNNRRGSCREKNRRKESVMSTAATMRVLNVL
RHWVSKHAQDFESDQKLKNLTIEFLEDIIYCPNLLPAEHKAASQLLRLITKEEPESSKVD
LKKLLASPIVQTKENIETLSALEIAEQMTYLDHKIFISISSEEFLGQAWMKVDKAARAPH
ILLMTKRFNEVSQLVVSEIIRRSNMAARVAAIEKWAAVADISRVLHNYNGVLQICAAFTN
SSVFRLKKTWEKVSKTTKQTIERLQNIVSSDGRFRNLRDALHRCDPPCIPYLGLYLTDLS
FIEEGTPTMTEEGLLNFSKMRMIAHVIREIRHFQQTPYKIELITKVTNYLLDPSLLLNEK
DLYRMSLEIEPRTSRLSSSTLINLPPSVSHTSTK
NT seq 3525 nt NT seq  +upstreamnt  +downstreamnt
atggagagctggcccactttagttttaggtgatttgtttgacatgttattacccatgttg
gcaatttatcaagaatatgtcagaaatcatcattacagtcttcaagtattaactgagtgc
aagcaatcctcttcatttgctgcattgctcactagattggagaataagactgcttgtgga
ggacgatctctagagacatttttaacgtatcctatgcatcagattccaagatatatcata
acattgcacgaactattagcacacactccttatgatcatgttgaacggaaaagtttacaa
aatgcgagacaacaattggaagatttgtcaagacaaatgcatgacgaagttagcgaaaca
gaaaatttacgaaaaaatttagctgtcgaacgaatgattgtagaaggatgcgatatttta
cttgatgtcaatcaagtattcgttagacagggtacactcatccaaattttagataagcca
aaaggagcgcgaagtagattgagtgcaacttttggaggaaaaagtggagataaggaagta
attagacaatgcttccttttttccaatcatttgttattaacgactcgtcaatcagacgat
gatggtcgtttgaatcttgttccacaaatcggaaaaatacctctttccgatgcggtgtta
gtggaggatcctaatgacctgggtactgcggatgatgatgcttcttcagctttgggactg
caacgacattccaagcaatggatgagctgtcttgtgcaaaacggtatcagtgagagcagc
ggtagtggtagcggaactgccagtagtcaagtacagaaccgtgacttcaaaattatactc
gatttgaaatctggtggaactcaagttatagtacatctcgtagctcctactattcaggaa
aaagctgcgtggatcagcgatatcagccaatgtatggataatgttcacttcaatgatttg
cttcgaggctcgttgtcagataccagttccgtcacgatgcctcaatccatccggaatgat
cctaaattgtttaaagatgatgtagacatcagattcagtagaactttaaattcttgcaaa
gtcccacaaattcgatcagccactcctgagcgtctacttcaacgattaacagatttaaga
tttctcagcattgattttctcaatacatttttattaacgtatcgagtatttaccgatggt
gttactgtgctcgaagctttgaaaaaagtcttttatgaagccgaaccaccagattctgag
atgcctactggttctctagtgtctctagatgtattgggagtaactacaacagattctaca
ttgcatgtagatgatagaagaagaagtagtgtttcaccacgaagaattagtggagatagt
tcagtttctggatatggatctgaaataagtgatagtcgcgaaataaaaagttcctatgat
tatcctggatatacccttaattcaaagggatattggcgaagtggatacaaaaaggtagat
gaagaacagcaattaggtttaatttcggaagctcctccgattataaaacgaagtcctact
atacaatcgtcttctgcatccattgattctcaatctcccgctacaccacggaagattagc
attcgcgtggacaaaaaagaagaagatgatggttgtcatttaacaataccaaaagtaatt
gcggtttcatcaagttctgaaactctaacagataatacagtaataagtgcaccttcctct
ccaagtaatcttagctctgttacgttagtcggatcaacgggttctggatcaggttctgga
tcagatcgaagtccacaagaggctacttattcacgtggtgcctcagaagaaacagataca
cctgtagcaacggatcttccaaaaaaagatgaacaatttatctacgaacattctgaagct
gaaatatcaaaacaaataaaagcaaatattccttcaacatcaaaagaaaaaaatactgaa
gtaattaaaattgaaataaacaaacacgaaaaagaaaaacaaacagcaaaagaaagtgaa
actagtgtctcaacaatgcaacctcaatctcctaaacaaattcaacaaagtctacagaat
caacaaaaacaacatttacatcaaagtgaacatagagcatcgattgcttctgcacctgcg
gctactgtaaggagtagctcgatttctacaataactggaaattattgggcgagcagacga
tcgattcaagaaatcgaaatgtcttctcaacaaggtaacttccaacacgaccaagtttct
agtaaggctggagtagtgattactagctttcgccagagtcatcgaagcattggacgtgta
cctttctggagtagtacctcgactgctgcaactgcatttgcaattgcaacatctgcatcg
agcaatcccccagataagggcatcgaaggaaataatcgtagaggttcgtgtcgagaaaaa
aacagacgaaaggaatcagttatgtcaactgcagccacgatgcgagtattaaacgtgttg
agacattgggtttcgaaacatgctcaagattttgaatctgatcaaaagttgaaaaatcta
acgatcgagttcttggaagatatcatttactgccctaatcttctcccagctgaacataaa
gctgcaagccagcttcttagattaatcacgaaagaagaaccagaaagtagcaaagtggat
ctcaagaaactattagcctctccaattgtgcaaactaaagagaatatcgagacattgtct
gcgcttgaaatcgcagaacaaatgacatacttggatcacaagatttttatatccatttcg
agcgaagaatttcttggacaagcatggatgaaagttgacaaggctgcacgtgctcctcac
attcttttaatgacaaagagattcaatgaagtgtctcagttagttgtttcagagattatt
cgccgttcaaatatggcagcacgagttgcagcgattgaaaaatgggcggcagttgcagat
attagtagagtcttgcataattataatggtgtattacaaatttgtgcagctttcacgaat
agcagtgttttcagattgaaaaaaacatgggaaaaagtttcaaaaacaacaaagcaaaca
attgaaagattacaaaacattgtttcttctgatgggcgttttagaaatctacgggatgct
ttacatcgatgtgatccaccttgcattccttatttaggattatatttaaccgatctttct
ttcatagaagaaggtacaccaaccatgaccgaagaaggccttttaaatttttccaaaatg
cgaatgattgctcacgtgattcgagaaatacgacattttcaacaaacaccatacaaaatt
gaattgataactaaagtaacgaattatttgctggatccatcattgctgctaaacgagaag
gatctctaccgcatgtctttggagattgaaccaagaacatccaggttaagtagttcaacc
ttaattaatctgccaccttctgtgagccacacatctacaaaataa

DBGET integrated database retrieval system