KEGG   Apis mellifera (honey bee): 726447Help
Entry
726447            CDS       T01057                                 

Definition
(RefSeq) histone H2B
  KO
K11252  histone H2B
Organism
ame  Apis mellifera (honey bee)
Brite
Chromosome and associated proteins [BR:ame03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    726447
Exosome [BR:ame04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   726447
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa DUF2514
Motif
Other DBs
NCBI-GeneID: 726447
NCBI-ProteinID: XP_001120889
BEEBASE: GB13012
UniProt: A0A088A7T2
Position
LG1
AA seq 123 aa AA seqDB search
MPPKTSGKAVKKAGKAQKNISKADKKKKRRRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDVFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgccaccaaagactagtggaaaagcagttaaaaaagctggtaaagctcaaaaaaatatc
agtaaagctgataaaaaaaagaaacgcagaaggaaggaaagttacgctatttacatttat
aaagttcttaaacaagtacatccagatactggtatttctagtaaagctatgagcattatg
aacagttttgtgaatgatgtatttgaacgcattgcggctgaagcatctcgcttggcacat
tataacaaaagatcaacgattacttctcgagaaattcaaactgctgtacgtttgcttctt
cctggtgagttagccaagcatgctgtcagtgaaggaactaaagccgttaccaaatatact
agctctaaataa

DBGET integrated database retrieval system