KEGG   Apis mellifera (honey bee): 726447Help
Entry
726447            CDS       T01057                                 

Gene name
GB13012
Definition
histone H2B.3-like
Orthology
K11252  
histone H2B
Organism
ame  Apis mellifera (honey bee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG1
AA seq 123 aa AA seqDB search
MPPKTSGKAVKKAGKAQKNISKADKKKKRRRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDVFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgccaccaaagactagtggaaaagcagttaaaaaagctggtaaagctcaaaaaaatatc
agtaaagctgataaaaaaaagaaacgcagaaggaaggaaagttacgctatttacatttat
aaagttcttaaacaagtacatccagatactggtatttctagtaaagctatgagcattatg
aacagttttgtgaatgatgtatttgaacgcattgcggctgaagcatctcgcttggcacat
tataacaaaagatcaacgattacttctcgagaaattcaaactgctgtacgtttgcttctt
cctggtgagttagccaagcatgctgtcagtgaaggaactaaagccgttaccaaatatact
agctctaaataa

DBGET integrated database retrieval system